Recombinant Human ZIK1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ZIK1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 384 of Human ZIK1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGKAFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFSQSAILNQHRRIHTGAKPYECGQCGKSFSQKATLIKHQRVHTGERPYKCGDCGKSFSQSSILIQHRRIHTGARPYECGQCGKSFSQKSGLIQHQVVHTGERPYECNKCGNSFSQCSSLIHHQKCHNT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ZIK1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZIK1 Protein

  • MGC119699
  • MGC119700
  • Zinc finger protein 762
  • zinc finger protein interacting with K protein 1 homolog (mouse)
  • zinc finger protein interacting with ribonucleoprotein K
  • ZNF762MGC119701

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-24633
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
NBP1-59254
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-83256
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB37861
Species: Hu
Applications: WB, Simple Western, ICC
H00058524-R01
Species: Hu
AF4937
Species: Hu
Applications: WB, IHC
NBP1-90042
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59196
Species: Hu
Applications: WB
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP2-37897
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00284307-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for ZIK1 Recombinant Protein (H00284307-P01) (0)

There are no publications for ZIK1 Recombinant Protein (H00284307-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIK1 Recombinant Protein (H00284307-P01) (0)

There are no reviews for ZIK1 Recombinant Protein (H00284307-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZIK1 Recombinant Protein (H00284307-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZIK1 Products

Bioinformatics Tool for ZIK1 Recombinant Protein (H00284307-P01)

Discover related pathways, diseases and genes to ZIK1 Recombinant Protein (H00284307-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZIK1 Recombinant Protein (H00284307-P01)

Discover more about diseases related to ZIK1 Recombinant Protein (H00284307-P01).
 

Pathways for ZIK1 Recombinant Protein (H00284307-P01)

View related products by pathway.

PTMs for ZIK1 Recombinant Protein (H00284307-P01)

Learn more about PTMs related to ZIK1 Recombinant Protein (H00284307-P01).

Blogs on ZIK1

There are no specific blogs for ZIK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
ZIK1 Antibody
NBP2-32507
NF-H Antibody
NB300-135

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZIK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZIK1