Novus Biologicals products are now on bio-techne.com

Recombinant Human ZIK1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human ZIK1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 384 of Human ZIK1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHSAKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSHYKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGKAFRGKYSLVQHQRVHTGERPWECNECGKFFSQTSHLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERPYKCGECGNSFSQSAILNQHRRIHTGAKPYECGQCGKSFSQKATLIKHQRVHTGERPYKCGDCGKSFSQSSILIQHRRIHTGARPYECGQCGKSFSQKSGLIQHQVVHTGERPYECNKCGNSFSQCSSLIHHQKCHNT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
ZIK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
70.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZIK1 GST (N-Term) Protein

  • MGC119699
  • MGC119700
  • Zinc finger protein 762
  • zinc finger protein interacting with K protein 1 homolog (mouse)
  • zinc finger protein interacting with ribonucleoprotein K
  • ZNF762MGC119701

Background

ZIK1 may be a transcriptional repressor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
MAB3656
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NB300-135
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, WB
H00003400-B01P
Species: Hu, Mu
Applications: ICC/IF, WB
4575-RS
Species: Hu
Applications: BA
H00004499-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-15720
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-59254
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
DGB300
Species: Hu
Applications: ELISA
NBP1-83256
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
H00058524-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
MAB4937
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
NBP1-90042
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-59196
Species: Hu
Applications: WB
NBP3-21649
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-37897
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for ZIK1 Recombinant Protein (H00284307-P01) (0)

There are no publications for ZIK1 Recombinant Protein (H00284307-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZIK1 Recombinant Protein (H00284307-P01) (0)

There are no reviews for ZIK1 Recombinant Protein (H00284307-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZIK1 Recombinant Protein (H00284307-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZIK1 Products

Blogs on ZIK1

There are no specific blogs for ZIK1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZIK1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ZIK1