ZFX Antibody - BSA Free

Western Blot: ZFX Antibody [NBP2-86422] - Host: Rabbit. Target Name: ZFX. Sample Tissue: Human HT1080 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: ZFX Antibody [NBP2-86422] - WB Suggested Anti-ZFX Antibody Titration: 0.2-1 ug/ml. Positive Control: THP-1 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ZFX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZFX Antibody - BSA Free (NBP2-86422) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZFX. Peptide sequence: MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDIT The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZFX Antibody - BSA Free

• zinc finger protein, X-linked

Background

ZFX, also known as Zinc finger X-chromosomal protein, is a 91kDa 805 amino acid protein with a shorter 66kDa 576 isoform. The gene can be found in the nucleus where it encodes a member of the krueppel C2H2-type zinc-finger protein family. Current research is being conducted on ZFX in relation to the diseases azoospermia, prostate adenocarcinoma, premature ovarian failure and adenocarcinoma. ZFX is linked to the dosage compensation, sex determination, spermatogenesis, meiosis, cell cycle and fertilization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZFX