ZFX Antibody

Images

 
Western Blot: ZFX Antibody [NBP2-86421] - Host: Rabbit. Target Name: ZFX. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Rabbit Anti-ZFX Antibody. Paraffin Embedded Tissue: Human alveolar cell. Cellular Data: Epithelial cells of renal tubule. Antibody Concentration: 4.0-8.0 ug/ml. ...read more
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE).. Antibody Concentration: 10 ug/ml.
Immunohistochemistry-Paraffin: ZFX Antibody [NBP2-86421] - Human Skin: Formalin-Fixed, Paraffin-Embedded (FFPE).. Antibody Concentration: 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFX Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZFX. Peptide sequence: KVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYM The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZFX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFX Antibody

  • zinc finger protein, X-linked

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20948
Species: Hu
Applications: WB
NBP2-37463
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB
NBP1-47256
Species: Hu, Mu
Applications: ICC/IF, IP, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-03621
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-55328
Species: Hu
Applications: IP, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB
AF1997
Species: Hu
Applications: ChIP, ICC, IHC, WB
MAB2018
Species: Hu, Mu, Rt
Applications: CyTOF-reported, ICC, ICFlow, Simple Western, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP3-09203
Species: Mu
Applications: WB
NBP2-86421
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ZFX Antibody (NBP2-86421) (0)

There are no publications for ZFX Antibody (NBP2-86421).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFX Antibody (NBP2-86421) (0)

There are no reviews for ZFX Antibody (NBP2-86421). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFX Antibody (NBP2-86421) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFX Products

Bioinformatics Tool for ZFX Antibody (NBP2-86421)

Discover related pathways, diseases and genes to ZFX Antibody (NBP2-86421). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFX Antibody (NBP2-86421)

Discover more about diseases related to ZFX Antibody (NBP2-86421).
 

Pathways for ZFX Antibody (NBP2-86421)

View related products by pathway.

PTMs for ZFX Antibody (NBP2-86421)

Learn more about PTMs related to ZFX Antibody (NBP2-86421).
 

Research Areas for ZFX Antibody (NBP2-86421)

Find related products by research area.

Blogs on ZFX

There are no specific blogs for ZFX, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFX