ZFP106 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of human ZFP106. Peptide sequence: QKESELQMTSAASPHPGLLLDLKTSLEDAQVDDSIKSHVSYETEGFESAS The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ZFP106 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ZFP106 Antibody - BSA Free
Background
Zinc finger protein homolog 106 (ZFP106) is a C2H2-type zinc finger protein that also contains 2 WD repeats. ZFP106 is highly expressed in striated muscle, brown fat, and developing brain and is regulated by myogenin and nuclear respiratory factor-1 (NRF-1). ZFP106 localizes to the nucleus in association with nucleolar transcriptional machinery. The WD40 repeat in ZFP106 appears to facilitate targeting of ZFP106 to the nucleolus and to mediate the interaction between ZFP106 and testis-specific gene 118 (TSF118). A two-hybrid screen has identified testis-specific Y-encoded-like protein (TSPYL) as a ZFP106 interacting protein. These data suggest an important role for ZFP106 in testis development.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Bind
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Publications for ZFP106 Antibody (NBP2-88616) (0)
There are no publications for ZFP106 Antibody (NBP2-88616).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ZFP106 Antibody (NBP2-88616) (0)
There are no reviews for ZFP106 Antibody (NBP2-88616).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ZFP106 Antibody (NBP2-88616) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ZFP106 Products
Blogs on ZFP106