ZFHX4 Antibody - BSA Free

Western Blot: ZFHX4 Antibody [NBP2-88615] - Host: Rabbit. Target Name: ZFHX4. Sample Tissue: Human THP-1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

ZFHX4 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZFHX4. Peptide sequence: METCDSPPISRQENGQSTSKLCGTTQLDNEVPEKVAGMEPDRENSSTDDN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFHX4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ZFHX4 Antibody - BSA Free

• FLJ16514
• FLJ20980
• ZFH-4
• ZFH4ZHF4
• zinc finger homeobox 4
• zinc finger homeobox protein 4
• zinc finger homeodomain 4
• Zinc finger homeodomain protein 4
• zinc-finger homeodomain protein 4

Background

ZFHX4 - zinc finger homeodomain 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZFHX4