ZDHHC5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZDHHC5 Antibody [NBP1-81376] - Staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cell junctions. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ZDHHC5 Antibody [NBP1-81376] - Staining of human placenta shows positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ZDHHC5 Antibody [NBP1-81376] - Staining of human cervix, uterine shows membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: ZDHHC5 Antibody [NBP1-81376] - Staining of human duodenum shows membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: ZDHHC5 Antibody [NBP1-81376] - Staining of human esophagus shows membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: ZDHHC5 Antibody [NBP1-81376] - Staining of human pancreas shows membranous positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZDHHC5 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation Reported in the scientific literature (PMID: 26334723)
  • Western Blot Reported in the scientific literature (PMID: 26334723)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZDHHC5 Protein (NBP1-81376PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZDHHC5 Antibody - BSA Free

• DHHC domain containing 5
• DKFZp586K0524
• zinc finger, DHHC-type containing 5
• ZNF375

Background

ZDHHC5 is a gene that codes for a protein with two isoforms, measuring 715 and 662 amino acids in length, with weights of approximately 78 and 72 kDa respectively. ZDHHC5 functions as a palmitoyl acyltransferase for the G-protein coupled receptor. Current research is being done on diseases and disorders related to this gene including malaria. ZDHHC5 has also been shown to have interactions with SSTR5 and UBC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZDHHC5 Antibody (NBP1-81376)(4)

Publications using NBP1-81376

• Brigidi GS, Santyr B, Shimell J et al. Activity-regulated trafficking of the palmitoyl-acyl transferase DHHC5. Nat Commun. 2015-09-03 [PMID: 26334723] (WB, ICC/IF, IP, Human)
• Brigidi GS, Sun Y, Beccano-Kelly D et al. Palmitoylation of delta-catenin by DHHC5 mediates activity-induced synapse plasticity. Nat Neurosci 2014-04-01 [PMID: 24562000]
• Li Y, Martin BR, Cravatt BF, Hofmann SL. DHHC5 Protein Palmitoylates Flotillin-2 and Is Rapidly Degraded on Induction of Neuronal Differentiation in Cultured Cells. J Biol Chem 2012-01-02 [PMID: 22081607]
• Li Y, Hu J, Hofer K et al. DHHC5 interacts with PDZ domain 3 of post-synaptic density-95 (PSD-95) protein and plays a role in learning and memory. J Biol Chem 2010-04-01 [PMID: 20178993]

Bioinformatics

• Gene Symbol: ZDHHC5