ZDHHC16 Antibody


Western Blot: ZDHHC16 Antibody [NBP2-55212] - Analysis using Anti-ZDHHC16 antibody NBP2-55212 (A) shows similar pattern to independent antibody NBP1-89041 (B).
Immunocytochemistry/ Immunofluorescence: ZDHHC16 Antibody [NBP2-55212] - Staining of human cell line A-431 shows localization to nucleus, nuclear membrane & cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

ZDHHC16 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LFREAYAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHK
Specificity of human ZDHHC16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for ZDHHC16 Antibody

  • DHHC domain containing 16
  • EC 2.3.1
  • EC 2.3.1.-
  • zinc finger, DHHC-type containing 16


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, Flow-IC

Publications for ZDHHC16 Antibody (NBP2-55212) (0)

There are no publications for ZDHHC16 Antibody (NBP2-55212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZDHHC16 Antibody (NBP2-55212) (0)

There are no reviews for ZDHHC16 Antibody (NBP2-55212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZDHHC16 Antibody (NBP2-55212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ZDHHC16 Products

Bioinformatics Tool for ZDHHC16 Antibody (NBP2-55212)

Discover related pathways, diseases and genes to ZDHHC16 Antibody (NBP2-55212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ZDHHC16 Antibody (NBP2-55212)

View related products by pathway.

Research Areas for ZDHHC16 Antibody (NBP2-55212)

Find related products by research area.

Blogs on ZDHHC16

There are no specific blogs for ZDHHC16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZDHHC16 Antibody and receive a gift card or discount.


Gene Symbol ZDHHC16