ZCCHC5 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ZCCHC5 Antibody [NBP2-57937] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & the Golgi apparatus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZCCHC5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZCCHC5 Antibody - BSA Free (NBP2-57937) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SYIVLKLENEIRQAQVQWLMEENAALQAQIPELQKSQAAKEYDLLRKSSEAKEPQKLPEHMNPPAAWEAQKTPEFKEPQKP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZCCHC5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ZCCHC5 Recombinant Protein Antigen (NBP2-57937PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZCCHC5 Antibody - BSA Free

• zinc finger CCHC domain-containing protein 5
• Mar3
• Mart3
• ZHC5
• zinc finger, CCHC domain containing 5

Background

The ZCCHC5 gene is a member of a family of gag-related retrotransposon genes. These genes appear to have lost the ability toretrotranspose; however, their open reading frames have remained intact, which may indicate that these genes haveacquired new functions i

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZCCHC5