ZC3H7B Antibody - BSA Free

Western Blot: ZC3H7B Antibody [NBP2-83793] - WB Suggested Anti-ZC3H7B Antibody Titration: 4ug/ml. Positive Control: Human Liver

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

ZC3H7B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZC3H7B Antibody - BSA Free (NBP2-83793) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human ZC3H7B. Peptide sequence: YECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZC3H7B
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for ZC3H7B Antibody - BSA Free

• FLJ13787
• Rotavirus 'X' associated non-structural protein
• rotavirus X protein associated with NSP3
• zinc finger CCCH-type containing 7B

Background

The ZC3H7B gene encodes a protein that contains a tetratricopeptide repeat domain. The encoded protein also interacts with the rotavirus non-structural protein NSP3. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZC3H7B