ZBTB14 Antibody

Western Blot: ZBTB14 Antibody [NBP2-57846] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: ZBTB14 Antibody [NBP2-57846] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Discontinued

ZBTB14 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPCVCEMCTKGFTTQAHLKEH
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZBTB14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ZBTB14 Antibody

• ZF5;ZFP161;ZFP-161;ZFP-5;Zinc finger and BTB domain-containing protein 14;ZNF478

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZBTB14