ZBTB14 Antibody

Images

 
Western Blot: ZBTB14 Antibody [NBP2-57846] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: ZBTB14 Antibody [NBP2-57846] - Staining of human cell line MCF7 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZBTB14 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPCVCEMCTKGFTTQAHLKEH
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZBTB14
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZBTB14 Recombinant Protein Antigen (NBP2-57846PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-76519
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-30682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36064
Species: Hu
Applications: IHC, IHC-Fr, WB
NBP1-86460
Species: Hu
Applications: IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1687
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-54719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP1-80115
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13181
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF4937
Species: Hu
Applications: IHC, WB
H00001032-M08
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-57846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for ZBTB14 Antibody (NBP2-57846) (0)

There are no publications for ZBTB14 Antibody (NBP2-57846).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBTB14 Antibody (NBP2-57846) (0)

There are no reviews for ZBTB14 Antibody (NBP2-57846). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZBTB14 Antibody (NBP2-57846) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB14 Products

Bioinformatics Tool for ZBTB14 Antibody (NBP2-57846)

Discover related pathways, diseases and genes to ZBTB14 Antibody (NBP2-57846). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZBTB14 Antibody (NBP2-57846)

Discover more about diseases related to ZBTB14 Antibody (NBP2-57846).
 

Pathways for ZBTB14 Antibody (NBP2-57846)

View related products by pathway.

PTMs for ZBTB14 Antibody (NBP2-57846)

Learn more about PTMs related to ZBTB14 Antibody (NBP2-57846).

Blogs on ZBTB14

There are no specific blogs for ZBTB14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB14 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB14