ZBTB14 Antibody (4F7)

Images

 
Western Blot: ZFP161 Antibody (4F7) [H00007541-M02] - Analysis of ZFP161 expression in transfected 293T cell line by ZFP161 monoclonal antibody (M02), clone 4F7.Lane 1: ZFP161 transfected lysate (Predicted MW: 51 ...read more
ELISA: ZFP161 Antibody (4F7) [H00007541-M02] - Detection limit for recombinant GST tagged ZFP161 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZBTB14 Antibody (4F7) Summary

Immunogen
ZFP161 (NP_003400.2, 311 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTP
Specificity
ZFP161 - zinc finger protein 161 homolog (mouse) (4F7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZBTB14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-76519
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
DPSG10
Species: Hu
Applications: ELISA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NBP2-30682
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36064
Species: Hu
Applications: IHC, IHC-Fr, WB
NBP1-86460
Species: Hu
Applications: IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1687
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, IP, WB
NBP2-54719
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF3756
Species: Hu, Mu, Rt
Applications: WB
NBP1-80115
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13181
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF4937
Species: Hu
Applications: IHC, WB
H00001032-M08
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00007541-M02
Species: Hu
Applications: WB, ELISA

Publications for ZFP161 Antibody (H00007541-M02) (0)

There are no publications for ZFP161 Antibody (H00007541-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP161 Antibody (H00007541-M02) (0)

There are no reviews for ZFP161 Antibody (H00007541-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZFP161 Antibody (H00007541-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZBTB14 Products

Bioinformatics Tool for ZFP161 Antibody (H00007541-M02)

Discover related pathways, diseases and genes to ZFP161 Antibody (H00007541-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP161 Antibody (H00007541-M02)

Discover more about diseases related to ZFP161 Antibody (H00007541-M02).
 

Pathways for ZFP161 Antibody (H00007541-M02)

View related products by pathway.

PTMs for ZFP161 Antibody (H00007541-M02)

Learn more about PTMs related to ZFP161 Antibody (H00007541-M02).

Blogs on ZBTB14

There are no specific blogs for ZBTB14, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZBTB14 Antibody (4F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZBTB14
Entrez
Uniprot