ZA20D3 Antibody - BSA Free

Western Blot: ZA20D3 Antibody [NBP2-83782] - WB Suggested Anti-ZA20D3 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysateZFAND6 is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: ZA20D3 Antibody [NBP2-83782] - Human kidney

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 1 mg/ml

ZA20D3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZA20D3 Antibody - BSA Free (NBP2-83782) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZA20D3. Peptide sequence: SDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFAND6
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 1 mg/ml
• Purity: Protein A purified

Alternate Names for ZA20D3 Antibody - BSA Free

• Associated with PRK1 protein
• AWP1Zinc finger A20 domain-containing protein 3
• protein associated with PRK1
• ZA20D3AN1-type zinc finger protein 6
• ZFAND5B
• zinc finger, A20 domain containing 3
• zinc finger, AN1-type domain 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZFAND6