YIPF1 Antibody

Images

 
Western Blot: YIPF1 Antibody [NBP1-70750] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

YIPF1 Antibody Summary

Immunogen
Synthetic peptides corresponding to YIPF1(Yip1 domain family, member 1) The peptide sequence was selected from the middle region of YIPF1. Peptide sequence HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YIPF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against YIPF1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for YIPF1 Antibody

  • Yip1 domain family, member 1

Background

YIPF1 is a multi-pass membrane protein. It belongs to the YIP1 family. The exact function of YIPF1 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1195
Species: Hu
Applications: WB, IHC, Neut
H00114769-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF1085
Species: Mu
Applications: WB, IHC, Neut
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005535-T01
Species: Hu
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-70750
Species: Hu
Applications: WB

Publications for YIPF1 Antibody (NBP1-70750) (0)

There are no publications for YIPF1 Antibody (NBP1-70750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YIPF1 Antibody (NBP1-70750) (0)

There are no reviews for YIPF1 Antibody (NBP1-70750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YIPF1 Antibody (NBP1-70750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YIPF1 Products

YIPF1 NBP1-70750

Bioinformatics Tool for YIPF1 Antibody (NBP1-70750)

Discover related pathways, diseases and genes to YIPF1 Antibody (NBP1-70750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on YIPF1

There are no specific blogs for YIPF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YIPF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YIPF1