XLF Recombinant Protein Antigen

Images

 
There are currently no images for XLF Recombinant Protein Antigen (NBP2-55106PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

XLF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to XLF.

Source: E. coli

Amino Acid Sequence: FLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NHEJ1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55106.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XLF Recombinant Protein Antigen

  • Cernunnos
  • non-homologous end-joining factor 1
  • nonhomologous end-joining factor 1
  • Protein cernunnos
  • XLFFLJ12610
  • XRCC4-like factor

Background

Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89463
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22128
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-183
Species: Hu
Applications: WB
NBP2-34247
Species: Ch(-), Hu, Mu(-), Pm, Rt(-)
Applications: Flow-IC, Flow, ICC/IF
NB100-508
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
NB100-81665
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-41190
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for XLF Recombinant Protein Antigen (NBP2-55106PEP) (0)

There are no publications for XLF Recombinant Protein Antigen (NBP2-55106PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XLF Recombinant Protein Antigen (NBP2-55106PEP) (0)

There are no reviews for XLF Recombinant Protein Antigen (NBP2-55106PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XLF Recombinant Protein Antigen (NBP2-55106PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XLF Products

Array NBP2-55106PEP

Research Areas for XLF Recombinant Protein Antigen (NBP2-55106PEP)

Find related products by research area.

Blogs on XLF.

Ku70: The DNA's Mr. Fix-it
Ku70, known by several synonyms including X-ray repair cross-complementing, 5'-deoxyribose-5-phosphate lyase Ku70 protein 6, 70 kDa subunit of Ku antigen, XRCC6, and G22P1, is a 70 kDa protein that was shown to be involved in multiple cellular pathway...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XLF Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NHEJ1