Home » XLF » XLF Antibodies » XLF Antibody

XLF Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: XLF Antibody [H00079840-B01P] - Analysis of NHEJ1 expression in transfected 293T cell line by NHEJ1 polyclonal antibody. Lane 1: XLF transfected lysate(32.89 KDa). Lane 2: Non-transfected lysate.
Western Blot: XLF Antibody [H00079840-B01P] - Analysis of NHEJ1 expression in transfected 293T cell line by NHEJ1 polyclonal antibody. Lane 1: XLF transfected lysate(32.89 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: XLF Antibody [H00079840-B01P] - Analysis of purified antibody to NHEJ1 on HepG2 cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Product Discontinued
View other related XLF Primary Antibodies

Order Details


    • Catalog Number
      H00079840-B01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

XLF Antibody Summary

Immunogen
NHEJ1 (NP_079058.1, 1 a.a. - 299 a.a.) full-length human protein. MEELEQGLLMQPWAWLQLAENSLLAKVFITKQGYALLVSDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAAFLCHLDNLLRPLLKDAAHPSEATFSCDCVADALILRVRSELSGLPFYWNFHCMLASPSLVSQHLIRPLMGMSLALQCQVRELATLLHMKDLEIQDYQESGATLIRDRLKTEPFEENSFLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSAPTLSAPEKESTGTSGPLQRPQLSKVKRKKPRGLFS
Specificity
NHEJ1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NHEJ1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
This antibody is useful for ELISA, immunofluorescence, and Western Blot.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for XLF Antibody

  • Cernunnos
  • non-homologous end-joining factor 1
  • nonhomologous end-joining factor 1
  • Protein cernunnos
  • XLFFLJ12610
  • XRCC4-like factor

Background

Double-strand breaks in DNA result from genotoxic stresses and are among the most damaging of DNA lesions. This gene encodes a DNA repair factor essential for the nonhomologous end-joining pathway, which preferentially mediates repair of double-stranded breaks. Mutations in this gene cause different kinds of severe combined immunodeficiency disorders. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

XRCC4 Antibody -
BSA Free
NBP1-89463
Immunocytochemistry/ Immunofluorescence XRCC4 Antibody - BSA Free
Immunohistochemistry-Paraffin XRCC4 Antibody - BSA Free
Western Blot XRCC4 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
DNA Ligase IV
Antibody - BSA Free
NBP2-16182
Western Blot DNA Ligase IV Antibody - BSA Free
Immunohistochemistry-Paraffin DNA Ligase IV Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence DNA Ligase IV Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DNA-PKcs Antibody
NB100-658
Western Blot DNA-PKcs Antibody
Western Blot DNA-PKcs Antibody
Western Blot DNA-PKcs Antibody
(1 Review)
(3 Publications)
Species: Hu
Applications: IP, KD, WB
Artemis Antibody -
BSA Free
NB100-183
Western Blot Artemis Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: WB
Ku70/XRCC6
Antibody (KU729)
NBP2-34247
Flow Cytometry Ku70/XRCC6 Antibody (KU729)
Flow Cytometry Ku70/XRCC6 Antibody (KU729)
Immunocytochemistry/ Immunofluorescence Ku70/XRCC6 Antibody (KU729)
(1 Review)
Species: Ch(-), Hu, Mu(-), Pm, Rt(-)
Applications: Flow-IC, Flow, ICC/IF
Ku80/XRCC5
Antibody - BSA Free
NB100-508
Western Blot Ku80/XRCC5 Antibody - BSA Free
Immunoprecipitation Ku80/XRCC5 Antibody - BSA Free
Western Blot Ku80/XRCC5 Antibody - BSA Free
(1 Review)
(5 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
ATM Antibody (2C1)
- Azide and BSA Free
NB100-309
Western Blot ATM Antibody (2C1) - Azide and BSA Free
Western Blot ATM Antibody (2C1) - Azide and BSA Free
Immunoprecipitation ATM Antibody (2C1) - Azide and BSA Free
(3 Reviews)
(132 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
53BP1 Antibody -
BSA Free
NB100-304
Western Blot 53BP1 Antibody - BSA Free
Knockout Validated 53BP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence 53BP1 Antibody - BSA Free
(14 Reviews)
(817 Publications)
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, ISH, KD, KO, WB
PARP Antibody
(194C1439) - Cleaved ...
NBP2-27335
Immunocytochemistry/ Immunofluorescence PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
Western Blot PARP Antibody (194C1439) - Cleaved - Azide and BSA Free
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
Nbs1 Antibody -
BSA Free
NB100-143
Western Blot Nbs1 Antibody - BSA Free
Western Blot Nbs1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Nbs1 Antibody - BSA Free
(8 Reviews)
(206 Publications)
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
DNA Polymerase
lambda Antibody - BSA ...
NB100-81665
Immunohistochemistry-Paraffin DNA Polymerase lambda Antibody - BSA Free
Immunohistochemistry-Paraffin DNA Polymerase lambda Antibody - BSA Free
Immunoprecipitation DNA Polymerase lambda Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB (-)
FAM60A Antibody -
Azide and BSA Free
H00058516-B02P
Western Blot FAM60A Antibody - Azide and BSA Free
Western Blot FAM60A Antibody - Azide and BSA Free
Knockdown Validated FAM60A Antibody - Azide and BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
Chk2 Antibody
(OTI5C4) - Azide and ...
NBP2-71688
Western Blot Chk2 Antibody (OTI5C4) - Azide and BSA Free
CyTOF-ready Chk2 Antibody (OTI5C4) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Chk2 Antibody (OTI5C4) - Azide and BSA Free
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
DNA Ligase III
Antibody (1F3) - Azid ...
NBP1-41190
Western Blot DNA Ligase III Antibody (1F3) - Azide and BSA Free
Western Blot DNA Ligase III Antibody (1F3) - Azide and BSA Free
(10 Publications)
Species: Ch, Hu, Mu
Applications: B/N, ICC/IF, IP, PLA, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(45 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
XLF Antibody
H00079840-B01P
XLF Antibody
Species: Hu
Applications: WB, ICC/IF

Publications for XLF Antibody (H00079840-B01P) (0)

There are no publications for XLF Antibody (H00079840-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XLF Antibody (H00079840-B01P) (0)

There are no reviews for XLF Antibody (H00079840-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for XLF Antibody (H00079840-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional XLF Products

Array H00079840-B01P

Research Areas for XLF Antibody (H00079840-B01P)

Find related products by research area.

Blogs on XLF.

Check out the latest blog posts on XLF.
Ku70: The DNA's Mr. Fix-it
Ku70, known by several synonyms including X-ray repair cross-complementing, 5'-deoxyribose-5-phosphate lyase Ku70 protein 6, 70 kDa subunit of Ku antigen, XRCC6, and G22P1, is a 70 kDa protein that was shown to be involved in multiple cellular pathway...  Read full blog post.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our XLF Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NHEJ1
Entrez
Uniprot