Recombinant Human Wnt-6 Protein

Images

 
SDS-Page: Recombinant Human Wnt-6 Protein [H00007475-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Wnt-6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-365 of Human WNT6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
WNT6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
66.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00007475-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Wnt-6 Protein

  • protein Wnt-6
  • wingless-type MMTV integration site family, member 6
  • Wnt6
  • Wnt-6

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is overexpressed in cervical cancer cell line and strongly coexpressed with another family member, WNT10A, in colorectal cancer cell line. The gene overexpression may play key roles in carcinogenesis. This gene and the WNT10A gene are clustered in the chromosome 2q35 region. The protein encoded by this gene is 97% identical to the mouse Wnt6 protein at the amino acid level. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4751
Species: Hu, Mu
Applications: WB, IHC, ICC
645-WN/CF
Species: Hu, Mu
NBP2-75713
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76916
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-51575
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3157
Species: Hu
Applications: WB, IHC
3669-WN/CF
Species: Mu
AF3460
Species: Hu
Applications: WB, IHC
6179-WN/CF
Species: Hu
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
AF3367
Species: Hu, Mu
Applications: WB
3008-WN/CF
Species: Hu
22950002
Species: Hu
Applications: ELISA, IHC, IHC-P
AF2248
Species: Mu
Applications: WB, IHC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007475-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Wnt-6 Recombinant Protein (H00007475-P01)(1)

We have publications tested in 1 application: ELISA.


Filter By Application
ELISA
(1)
All Applications
Filter By Species
All Species

Reviews for Wnt-6 Recombinant Protein (H00007475-P01) (0)

There are no reviews for Wnt-6 Recombinant Protein (H00007475-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Wnt-6 Recombinant Protein (H00007475-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Wnt-6 Recombinant Protein (H00007475-P01)

Discover related pathways, diseases and genes to Wnt-6 Recombinant Protein (H00007475-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Wnt-6 Recombinant Protein (H00007475-P01)

Discover more about diseases related to Wnt-6 Recombinant Protein (H00007475-P01).
 

Pathways for Wnt-6 Recombinant Protein (H00007475-P01)

View related products by pathway.

PTMs for Wnt-6 Recombinant Protein (H00007475-P01)

Learn more about PTMs related to Wnt-6 Recombinant Protein (H00007475-P01).
 

Research Areas for Wnt-6 Recombinant Protein (H00007475-P01)

Find related products by research area.

Blogs on Wnt-6

There are no specific blogs for Wnt-6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Wnt-5a
645-WN-010

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Wnt-6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WNT6