WNK2 Antibody (2E10)

Images

 
Immunohistochemistry-Paraffin: WNK2 Antibody (2E10) [H00065268-M01] - Analysis of monoclonal antibody to WNK2 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: WNK2 Antibody (2E10) [H00065268-M01] - Detection limit for recombinant GST tagged WNK2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P
Clone
2E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

WNK2 Antibody (2E10) Summary

Immunogen
WNK2 (NP_006639, 2118 a.a. ~ 2218 a.a) partial recombinant protein with GST tag.KGTFTDDLHKLVDEWTSKTVGAAQLKPTLNQLKQTQKLQDME AQAGWAAPGEARAMTAPRAGVGMPRLPPAPGPLSTTVIPGAA PTLSVPTPDPESEKPD
Specificity
WNK2 - WNK lysine deficient protein kinase 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WNK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WNK2 Antibody (2E10)

  • EC 2.7.11
  • EC 2.7.11.1
  • PRK
  • PRKWNK2
  • Protein kinase with no lysine 2
  • SDCCAG43
  • serine/threonine-protein kinase WNK2
  • Serologically defined colon cancer antigen 43lysine deficient 2
  • WNK lysine deficient protein kinase 2

Background

The protein encoded by this gene is a cytoplasmic serine-threonine kinase that contains cysteine in place of the lysine found at the conserved ATP-binding location in subdomain II of protein kinases. Since this protein does have kinase activity, it is possible that another lysine in the kinase subdomain I can substitute for the missing conserved lysine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NB100-56077
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56363
Species: Hu, Mu
Applications: WB
AF4559
Species: Hu
Applications: WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46228
Species: Hu
Applications: WB, IHC

Publications for WNK2 Antibody (H00065268-M01) (0)

There are no publications for WNK2 Antibody (H00065268-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WNK2 Antibody (H00065268-M01) (0)

There are no reviews for WNK2 Antibody (H00065268-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WNK2 Antibody (H00065268-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WNK2 Products

Bioinformatics Tool for WNK2 Antibody (H00065268-M01)

Discover related pathways, diseases and genes to WNK2 Antibody (H00065268-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WNK2 Antibody (H00065268-M01)

Discover more about diseases related to WNK2 Antibody (H00065268-M01).
 

Pathways for WNK2 Antibody (H00065268-M01)

View related products by pathway.

PTMs for WNK2 Antibody (H00065268-M01)

Learn more about PTMs related to WNK2 Antibody (H00065268-M01).
 

Research Areas for WNK2 Antibody (H00065268-M01)

Find related products by research area.

Blogs on WNK2

There are no specific blogs for WNK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WNK2 Antibody (2E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol WNK2
Entrez
OMIM
Uniprot