| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 3C1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse WIPI1 Antibody (3C1) - Azide and BSA Free (H00055062-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-WIPI1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | WIPI1 (NP_060453.2, 348 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQ |
| Specificity | WIPI1 (3C1) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | WIPI1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00055062-M02 | Applications | Species |
|---|---|---|
| Proikas-Cezanne T Automated Detection of Autophagy Response Using Single Cell-Based Microscopy Assays. Methods Mol Biol. 2019-02-06 [PMID: 30610713] |
Secondary Antibodies |
Isotype Controls |
Research Areas for WIPI1 Antibody (H00055062-M02)Find related products by research area.
|
|
Epigenetic Control of Autophagy By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi... Read full blog post. |
|
WIPI1 - An essential regulator of early autophagosome assembly WD repeat domain phosphoinositide-interacting protein 1 (WIPI) is involved in the lysosomal degradation of cytoplasmic components during starvation-induced autophagy. WIPI1 is a seven bladed beta-propeller protein that provides a scaffold for the ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.