WDR79 Recombinant Protein Antigen

Images

 
There are currently no images for WDR79 Recombinant Protein Antigen (NBP2-56099PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

WDR79 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR79.

Source: E. coli

Amino Acid Sequence: MKTLETQPLAPDCCPSDQDPAPAHPSPHASPMNKNADSELMPPPPERGDPPRLSPDPVAGSAVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WRAP53
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56099.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WDR79 Recombinant Protein Antigen

  • FLJ10385
  • TCAB1WDR79telomerase Cajal body protein 1
  • WD repeat containing, antisense to TP53
  • WD repeat domain 79
  • WD repeat-containing protein 79
  • WD40 protein Wrap53
  • WD40 repeat-containing protein encoding RNA antisense to p53
  • WD-encoding RNA antisense to p53

Background

WD-repeat domain 79 (WDR79) contains six WD (tryptophan-aspartate) repeat domains found in a number of proteins that function as adaptor molecules in signal transduction and cytoskeletal organization. The WD repeat is defined by four or more repeating units of a conserved core of approximately 40 amino acids ending with tryptophan-aspartic acid (WD). WD repeats may serve as sites of protein-protein interaction for adaptor proteins and facilitate multiprotein complex formation. The function of the WDR79 protein has not been characterized, however significant and consistent single nucleotide polymorphisms in the WDR79 gene have been found to be associated with ER negative breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-85156
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-13656
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-32441
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP3-45024
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-12461
Species: Hu, Rt
Applications: ELISA, IP, WB
NBP2-31742
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP2-13954
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-97768
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AF5489
Species: Hu
Applications: IHC, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-56099PEP
Species: Hu
Applications: AC

Publications for WDR79 Recombinant Protein Antigen (NBP2-56099PEP) (0)

There are no publications for WDR79 Recombinant Protein Antigen (NBP2-56099PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR79 Recombinant Protein Antigen (NBP2-56099PEP) (0)

There are no reviews for WDR79 Recombinant Protein Antigen (NBP2-56099PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WDR79 Recombinant Protein Antigen (NBP2-56099PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WDR79 Products

Research Areas for WDR79 Recombinant Protein Antigen (NBP2-56099PEP)

Find related products by research area.

Blogs on WDR79

There are no specific blogs for WDR79, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WDR79 Antibody
NB100-68252

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WDR79 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol WRAP53