WDR4 Antibody - Azide and BSA Free

Western Blot: WDR4 Antibody [H00010785-D01P] - Analysis of WDR4 expression in transfected 293T cell line by WDR4 polyclonal antibody.Lane 1: WDR4 transfected lysate(45.50 KDa).Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: WDR4 Antibody [H00010785-D01P] - Analysis of antibody to WDR4 on HeLa cell. Antibody concentration 10 ug/ml.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

WDR4 Antibody - Azide and BSA Free Summary

• Immunogen: WDR4 (NP_061139.2, 1 a.a. - 412 a.a.) full-length human protein. MAGSVGLALCGQTLVVRGGSRFLATSIASSDDDSLFIYDCSAAEKKSQENKGEDAPLDQGSGAILASTFSKSGSYFALTDDSKRLILFRTKPWQCLSVRTVARRCTALTFIASEEKVLVADKSGDVYSFSVLEPHGCGRLELGHLSMLLDVAVSPDDRFILTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRISVVPTQPGLLLSSSGDGTLRLWEYRSGRQLHCCHLASLQELVDPQAPQKFAASRIAFWCQENCVALLCDGTPVVYIFQLDARRQQLVYRQQLAFQHQVWDVAFEETQGLWVLQDCQEAPLVLYRPVGDQWQSVPESTVLKKVSGVLRGNWAMLEGSAGADASFSSLYKATFDNVTSYLKKKEERLQQQLEKKQRRRSPPPGPDGHAKKMRPGEATLSC
• Specificity: Reacts with WD repeat domain 4.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WDR4
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WDR4 Antibody - Azide and BSA Free

• tRNA (guanine-N(7)-)-methyltransferase subunit WDR4
• WD repeat domain 4, 10TRM82
• WD repeat-containing protein 4

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is excluded as a candidate for a form of nonsyndromic deafness (DFNB10), but is still a candidate for other disorders mapped to 21q22.3 as well as for the development of Down syndrome phenotypes. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WDR4
• Entrez:
  • 10785(Human)
• Uniprot:
  • NP_061139.2(Human)