WDR13 Antibody (1G9)

Images

 
Sandwich ELISA: WDR13 Antibody (1G9) [H00064743-M03] - Detection limit for recombinant GST tagged WDR13 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1G9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

WDR13 Antibody (1G9) Summary

Immunogen
WDR13 (NP_060353.2, 391 a.a. ~ 484 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVERAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRREQ
Specificity
WDR13 - WD repeat domain 13 (1G9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WDR13
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Control
WDR13 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for WDR13 Antibody (1G9)

  • DKFZp779C2057
  • FLJ20563
  • MG21
  • WD repeat domain 13
  • WD repeat-containing protein 13

Background

This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is widely expressed in various tissues, and located in chromosome X. The function of this gene has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-75930
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03285
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: All-NA
Applications: WB, IHC, IHC-P
NBP1-21367
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13412
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85699
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75547
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-59072
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85703
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00064743-M03
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for WDR13 Antibody (H00064743-M03) (0)

There are no publications for WDR13 Antibody (H00064743-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR13 Antibody (H00064743-M03) (0)

There are no reviews for WDR13 Antibody (H00064743-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR13 Antibody (H00064743-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional WDR13 Products

Bioinformatics Tool for WDR13 Antibody (H00064743-M03)

Discover related pathways, diseases and genes to WDR13 Antibody (H00064743-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WDR13 Antibody (H00064743-M03)

Discover more about diseases related to WDR13 Antibody (H00064743-M03).
 

Pathways for WDR13 Antibody (H00064743-M03)

View related products by pathway.

Blogs on WDR13

There are no specific blogs for WDR13, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR13 Antibody (1G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR13
Entrez
Uniprot