WBP11 Antibody - BSA Free

Western Blot: WBP11 Antibody [NBP1-54648] - Jurkat, Antibody Dilution: 1.0 ug/ml WBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.

Immunohistochemistry-Paraffin: WBP11 Antibody [NBP1-54648] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes; Primary Antibody Concentration: 1:100

Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate

Western Blot: WBP11 Antibody [NBP1-54648] - Hela cell lysate, concentration 0.2-1 ug/ml.

Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

• Reactivity: Hu, Mu
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

WBP11 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to WBP11(WW domain binding protein 11) The peptide sequence was selected from the N terminal of WBP11. Peptide sequence GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: WBP11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 70 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for WBP11 Antibody - BSA Free

• DKFZp779M1063
• Npw38-binding protein NpwBP
• Npw38-binding protein
• NpwBP
• NPWBPsplicing factor, PQBP1 and PP1 interacting
• SH3 domain-binding protein SNP70
• SIPP1WW domain-binding protein 11
• SNP70
• Splicing factor that interacts with PQBP-1 and PP1
• WBP-11
• WW domain binding protein 11

Background

WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: WBP11
• Uniprot:
  • Q9Y2W2(Human)