WBP11 Antibody


Western Blot: WBP11 Antibody [NBP1-54648] - Jurkat, Antibody Dilution: 1.0 ug/ml WBP11 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.
Immunocytochemistry/ Immunofluorescence: WBP11 Antibody [NBP1-54648] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes and their processes; ...read more
Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Mouse brain homogenate
Western Blot: WBP11 Antibody [NBP1-54648] - Hela cell lysate, concentration 0.2-1 ug/ml.
Western Blot: WBP11 Antibody [NBP1-54648] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IP

Order Details

WBP11 Antibody Summary

Synthetic peptides corresponding to WBP11(WW domain binding protein 11) The peptide sequence was selected from the N terminal of WBP11. Peptide sequence GRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPK.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunoprecipitation 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against WBP11 and was validated on Western blot.
Theoretical MW
70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for WBP11 Antibody

  • DKFZp779M1063
  • Npw38-binding protein NpwBP
  • Npw38-binding protein
  • NpwBP
  • NPWBPsplicing factor, PQBP1 and PP1 interacting
  • SH3 domain-binding protein SNP70
  • SIPP1WW domain-binding protein 11
  • SNP70
  • Splicing factor that interacts with PQBP-1 and PP1
  • WBP-11
  • WW domain binding protein 11


WBP11 is a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. WBP11has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.This gene encodes a nuclear protein, which colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. This protein has 95% amino acid sequence identity to the mouse Wbp11 protein. It contains two proline-rich regions that bind to the WW domain of Npw38, a nuclear protein, and thus this protein is also called Npw38-binding protein NpwBP. The Npw38-NpwBP complex may function as a component of an mRNA factory in the nucleus.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Rt, Am, Dr
Applications: WB, EM, ELISA, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP

Publications for WBP11 Antibody (NBP1-54648) (0)

There are no publications for WBP11 Antibody (NBP1-54648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WBP11 Antibody (NBP1-54648) (0)

There are no reviews for WBP11 Antibody (NBP1-54648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WBP11 Antibody (NBP1-54648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional WBP11 Products

Bioinformatics Tool for WBP11 Antibody (NBP1-54648)

Discover related pathways, diseases and genes to WBP11 Antibody (NBP1-54648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WBP11 Antibody (NBP1-54648)

Discover more about diseases related to WBP11 Antibody (NBP1-54648).

Pathways for WBP11 Antibody (NBP1-54648)

View related products by pathway.

PTMs for WBP11 Antibody (NBP1-54648)

Learn more about PTMs related to WBP11 Antibody (NBP1-54648).

Research Areas for WBP11 Antibody (NBP1-54648)

Find related products by research area.

Blogs on WBP11

There are no specific blogs for WBP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our WBP11 Antibody and receive a gift card or discount.


Gene Symbol WBP11