Recombinant Human WASF2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human WASF2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 73-172 of Human WASF2

Source: Wheat Germ

Amino Acid Sequence: DRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
WASF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human WASF2 Protein

  • IMD2
  • Protein WAVE-2
  • SCAR2suppressor of cyclic-AMP receptor (WASP-family)
  • Verprolin homology domain-containing protein 2
  • WAS protein family, member 2
  • WASP family Verprolin-homologous protein 2
  • WAVE2dJ393P12.2
  • wiskWASP family protein member 2

Background

WASF2 - WAS protein family, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5514
Species: Hu, Mu
Applications: WB
NB100-2307
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-59845
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP
NBP1-82512
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF5515
Species: Hu, Mu
Applications: WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87914
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65291
Species: Hu
AF5414
Species: Hu
Applications: WB, Simple Western
NBP1-83269
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
NBP2-14424
Species: Hu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for WASF2 Partial Recombinant Protein (H00010163-Q01) (0)

There are no publications for WASF2 Partial Recombinant Protein (H00010163-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WASF2 Partial Recombinant Protein (H00010163-Q01) (0)

There are no reviews for WASF2 Partial Recombinant Protein (H00010163-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WASF2 Partial Recombinant Protein (H00010163-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WASF2 Products

Bioinformatics Tool for WASF2 Partial Recombinant Protein (H00010163-Q01)

Discover related pathways, diseases and genes to WASF2 Partial Recombinant Protein (H00010163-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for WASF2 Partial Recombinant Protein (H00010163-Q01)

Discover more about diseases related to WASF2 Partial Recombinant Protein (H00010163-Q01).
 

Pathways for WASF2 Partial Recombinant Protein (H00010163-Q01)

View related products by pathway.

PTMs for WASF2 Partial Recombinant Protein (H00010163-Q01)

Learn more about PTMs related to WASF2 Partial Recombinant Protein (H00010163-Q01).

Blogs on WASF2

There are no specific blogs for WASF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

WASF2 Antibody
NBP2-37912

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human WASF2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol WASF2