Recombinant Human VRK2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VRK2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 260-360 of Human VRK2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI

Protein/Peptide Type
Partial Recombinant Protein
Gene
VRK2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VRK2 Protein

  • EC 2.7.11.1
  • serine/threonine-protein kinase VRK2
  • vaccinia related kinase 2
  • vaccinia virus B1R-related kinase 2
  • Vaccinia-related kinase 2
  • vaccinia-related kinase-2

Background

VRK2 - vaccinia related kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85822
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF6235
Species: Hu
Applications: WB
NBP2-58572
Species: Hu
Applications: ICC/IF, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P
NB100-122
Species: Hu, Mu, Rt, Fi, Ha, Pm, Sh
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-59826
Species: Hu
Applications: WB, Simple Western, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-82863
Species: Hu
Applications: IHC, IHC-P
AF4366
Species: Hu, Mu, Rt
Applications: WB
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007444-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for VRK2 Partial Recombinant Protein (H00007444-Q01) (0)

There are no publications for VRK2 Partial Recombinant Protein (H00007444-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VRK2 Partial Recombinant Protein (H00007444-Q01) (0)

There are no reviews for VRK2 Partial Recombinant Protein (H00007444-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VRK2 Partial Recombinant Protein (H00007444-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VRK2 Products

Bioinformatics Tool for VRK2 Partial Recombinant Protein (H00007444-Q01)

Discover related pathways, diseases and genes to VRK2 Partial Recombinant Protein (H00007444-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VRK2 Partial Recombinant Protein (H00007444-Q01)

Discover more about diseases related to VRK2 Partial Recombinant Protein (H00007444-Q01).
 

Pathways for VRK2 Partial Recombinant Protein (H00007444-Q01)

View related products by pathway.

PTMs for VRK2 Partial Recombinant Protein (H00007444-Q01)

Learn more about PTMs related to VRK2 Partial Recombinant Protein (H00007444-Q01).
 

Research Areas for VRK2 Partial Recombinant Protein (H00007444-Q01)

Find related products by research area.

Blogs on VRK2

There are no specific blogs for VRK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VRK2 Antibody (3B10)
H00007444-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VRK2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VRK2