Recombinant Human VPS41 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VPS41 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 755-853 of Human VPS41 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEMK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
VPS41

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VPS41 Protein

  • HVPS41
  • hVps41p
  • HVSP41
  • S53
  • vacuolar assembly protein 41
  • vacuolar protein sorting 41 (yeast homolog)
  • vacuolar protein sorting 41 (yeast)
  • vacuolar protein sorting 41 homolog (S. cerevisiae)
  • vacuolar protein sorting-associated protein 41 homolog

Background

VPS41 - vacuolar protein sorting 41 (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004675-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-76535
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82906
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-48785
Species: Hu
Applications: WB, IHC
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-33110
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
H00027072-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for VPS41 Partial Recombinant Protein (H00027072-Q01) (0)

There are no publications for VPS41 Partial Recombinant Protein (H00027072-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS41 Partial Recombinant Protein (H00027072-Q01) (0)

There are no reviews for VPS41 Partial Recombinant Protein (H00027072-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS41 Partial Recombinant Protein (H00027072-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS41 Products

Bioinformatics Tool for VPS41 Partial Recombinant Protein (H00027072-Q01)

Discover related pathways, diseases and genes to VPS41 Partial Recombinant Protein (H00027072-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS41 Partial Recombinant Protein (H00027072-Q01)

Discover more about diseases related to VPS41 Partial Recombinant Protein (H00027072-Q01).
 

Pathways for VPS41 Partial Recombinant Protein (H00027072-Q01)

View related products by pathway.

PTMs for VPS41 Partial Recombinant Protein (H00027072-Q01)

Learn more about PTMs related to VPS41 Partial Recombinant Protein (H00027072-Q01).
 

Research Areas for VPS41 Partial Recombinant Protein (H00027072-Q01)

Find related products by research area.

Blogs on VPS41.

VPS41 - An important regulator of lysosomal trafficking
Membrane fusion is an essential step during the trafficking of endosomes and vesicles throughout the cell. Membrane fusion events are facilitated by multisubunit tethering complexes (MTC) including CORVET and HOPS. These complexes interact with Rab...  Read full blog post.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
VPS41 Antibody
NBP1-81639

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VPS41 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS41