Recombinant Human VPS33B Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VPS33B Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human VPS33B partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAFPHRPDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQHEVDKLYKVENKPALSSNEQLCFLVRPRIKNMRYIASLVN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
VPS33B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VPS33B Protein

  • FLJ14848
  • hVPS33B
  • vacuolar protein sorting 33 homolog B (yeast)
  • vacuolar protein sorting 33B (yeast homolog)
  • vacuolar protein sorting 33B
  • vacuolar protein sorting-associated protein 33B

Background

Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and encodes the human ortholog of rat Vps33b which is homologous to the yeast class C Vps33 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89901
Species: Hu
Applications: WB, IHC, IHC-P
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20872
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1448
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
46770002
Species: Hu
Applications: ELISA
NBP1-84207
Species: Hu
Applications: IHC, IHC-P
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90820
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004498-R01
Species: Hu
NB100-1813
Species: Hu
Applications: WB, IP
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P

Publications for VPS33B Partial Recombinant Protein (H00026276-Q01) (0)

There are no publications for VPS33B Partial Recombinant Protein (H00026276-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS33B Partial Recombinant Protein (H00026276-Q01) (0)

There are no reviews for VPS33B Partial Recombinant Protein (H00026276-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VPS33B Partial Recombinant Protein (H00026276-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VPS33B Products

Bioinformatics Tool for VPS33B Partial Recombinant Protein (H00026276-Q01)

Discover related pathways, diseases and genes to VPS33B Partial Recombinant Protein (H00026276-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS33B Partial Recombinant Protein (H00026276-Q01)

Discover more about diseases related to VPS33B Partial Recombinant Protein (H00026276-Q01).
 

Pathways for VPS33B Partial Recombinant Protein (H00026276-Q01)

View related products by pathway.

PTMs for VPS33B Partial Recombinant Protein (H00026276-Q01)

Learn more about PTMs related to VPS33B Partial Recombinant Protein (H00026276-Q01).

Blogs on VPS33B

There are no specific blogs for VPS33B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VPS33B Antibody
NBP2-20874

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VPS33B Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS33B