VPS13D Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: VPS13D Antibody [NBP2-58336] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VPS13D Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
Specificity
Specificity of human VPS13D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VPS13D
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VPS13D Recombinant Protein Antigen (NBP2-58336PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for VPS13D Antibody

  • VPS13D vacuolar protein sorting 13 homolog D (S. cerevisiae)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85641
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-82052
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow, KO
MAB6408
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-19128
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2383
Species: Hu
Applications: WB, ICC/IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-32252
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-19804
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88937
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-67755
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4458
Species: Hu
Applications: WB, IHC
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-46316
Species: Hu
Applications: WB, IHC
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KO
NBP2-58336
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for VPS13D Antibody (NBP2-58336) (0)

There are no publications for VPS13D Antibody (NBP2-58336).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS13D Antibody (NBP2-58336) (0)

There are no reviews for VPS13D Antibody (NBP2-58336). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VPS13D Antibody (NBP2-58336) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional VPS13D Products

Bioinformatics Tool for VPS13D Antibody (NBP2-58336)

Discover related pathways, diseases and genes to VPS13D Antibody (NBP2-58336). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS13D Antibody (NBP2-58336)

Discover more about diseases related to VPS13D Antibody (NBP2-58336).
 

Pathways for VPS13D Antibody (NBP2-58336)

View related products by pathway.

PTMs for VPS13D Antibody (NBP2-58336)

Learn more about PTMs related to VPS13D Antibody (NBP2-58336).

Blogs on VPS13D

There are no specific blogs for VPS13D, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VPS13D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS13D