VPS13C Recombinant Protein Antigen

Images

 
There are currently no images for VPS13C Protein (NBP1-94044PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VPS13C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human VPS13C.

Source: E.coli

Amino Acid Sequence: RVHNQFSLVSDEDYLNPPVIDRMDVQLTKLTLYRTVIQPGIYHPDIQLLHPINLEFLVNRNLAASWYHKVPVVEIKGHLDSMNVSLNQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VPS13C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-94044.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for VPS13C Recombinant Protein Antigen

  • DKFZp686E0570
  • FLJ21361
  • KIAA1421
  • vacuolar protein sorting 13 homolog C (S. cerevisiae)
  • vacuolar protein sorting-associated protein 13C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85641
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-57262
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NLS1251
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55104
Species: Hu
Applications: WB, ICC/IF
NBP2-57976
Species: Hu
Applications: ICC/IF
NBP2-05081
Species: Hu
NBP1-94053
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77033
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-83950
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89545
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84854
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005122-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-56429
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2727
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-94044PEP
Species: Hu
Applications: AC

Publications for VPS13C Protein (NBP1-94044PEP) (0)

There are no publications for VPS13C Protein (NBP1-94044PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VPS13C Protein (NBP1-94044PEP) (0)

There are no reviews for VPS13C Protein (NBP1-94044PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VPS13C Protein (NBP1-94044PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional VPS13C Products

Array NBP1-94044PEP

Bioinformatics Tool for VPS13C Protein (NBP1-94044PEP)

Discover related pathways, diseases and genes to VPS13C Protein (NBP1-94044PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VPS13C Protein (NBP1-94044PEP)

Discover more about diseases related to VPS13C Protein (NBP1-94044PEP).
 

Pathways for VPS13C Protein (NBP1-94044PEP)

View related products by pathway.

PTMs for VPS13C Protein (NBP1-94044PEP)

Learn more about PTMs related to VPS13C Protein (NBP1-94044PEP).

Blogs on VPS13C

There are no specific blogs for VPS13C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VPS13C Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol VPS13C