Recombinant Human VNN3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VNN3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 175-274 of Human VNN3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
VNN3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VNN3 Protein

  • HSA238982
  • MGC171203
  • vanin 3

Background

VNN3 - vanin 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7999-AH
Species: Hu
H00008875-B01P
Species: Hu
Applications: WB
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1992
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Dr, Gt, GP, Ha, Mk, Rb, Sh, Sq, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB333
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-14891
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1339
Species: Hu
Applications: WB, Simple Western, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8519
Species: Hu, Mu, Rt
Applications: WB
H00055350-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for VNN3 Partial Recombinant Protein (H00055350-Q01) (0)

There are no publications for VNN3 Partial Recombinant Protein (H00055350-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VNN3 Partial Recombinant Protein (H00055350-Q01) (0)

There are no reviews for VNN3 Partial Recombinant Protein (H00055350-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VNN3 Partial Recombinant Protein (H00055350-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VNN3 Products

Bioinformatics Tool for VNN3 Partial Recombinant Protein (H00055350-Q01)

Discover related pathways, diseases and genes to VNN3 Partial Recombinant Protein (H00055350-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VNN3 Partial Recombinant Protein (H00055350-Q01)

Discover more about diseases related to VNN3 Partial Recombinant Protein (H00055350-Q01).

Blogs on VNN3

There are no specific blogs for VNN3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

VNN3 Antibody
NBP1-83201

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VNN3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VNN3