VMAT1/SLC18A1 Recombinant Protein Antigen

Images

 
There are currently no images for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

VMAT1/SLC18A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC18A1.

Source: E.coli

Amino Acid Sequence: PTFLYDMEFKEVNSSLHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISAHKNNCLQGTGFLEEEI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC18A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-58895. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for VMAT1/SLC18A1 Recombinant Protein Antigen

  • CGAT
  • SLC18A1
  • solute carrier family 18 (vesicular monoamine), member 1
  • VAT1
  • VMAT1

Background

The vesicular monoamine transporter acts to accumulate cytosolic monoamines into vesicles, using the proton gradient maintained across the vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A2 (MIM 193001).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47977
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-91348
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
NB120-15160
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-31386
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-86922
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-00688
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88769
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-12223
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
H00006532-D01P
Species: Hu, Mu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58895PEP
Species: Hu
Applications: AC

Publications for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP) (0)

There are no publications for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP) (0)

There are no reviews for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VMAT1/SLC18A1 Products

Bioinformatics Tool for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP)

Discover related pathways, diseases and genes to VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP)

Discover more about diseases related to VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP).
 

Pathways for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP)

View related products by pathway.

PTMs for VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP)

Learn more about PTMs related to VMAT1/SLC18A1 Recombinant Protein Antigen (NBP2-58895PEP).

Blogs on VMAT1/SLC18A1

There are no specific blogs for VMAT1/SLC18A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our VMAT1/SLC18A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC18A1