Recombinant Human VIP Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human VIP Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-169 of Human VIP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
VIP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human VIP Protein

  • MGC13587
  • PHM27
  • vasoactive intestinal peptide
  • VIP peptides
  • VIP

Background

The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
AF6380
Species: Mu
Applications: WB
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NBP1-31619
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48988
Species: Hu
Applications: IHC
MAB4077
Species: Hu
Applications: WB, IHC
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
H00007432-P02
Species: Hu
Applications: WB, ELISA, PA

Publications for VIP Recombinant Protein (H00007432-P02) (0)

There are no publications for VIP Recombinant Protein (H00007432-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VIP Recombinant Protein (H00007432-P02) (0)

There are no reviews for VIP Recombinant Protein (H00007432-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VIP Recombinant Protein (H00007432-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional VIP Products

Bioinformatics Tool for VIP Recombinant Protein (H00007432-P02)

Discover related pathways, diseases and genes to VIP Recombinant Protein (H00007432-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VIP Recombinant Protein (H00007432-P02)

Discover more about diseases related to VIP Recombinant Protein (H00007432-P02).
 

Pathways for VIP Recombinant Protein (H00007432-P02)

View related products by pathway.

PTMs for VIP Recombinant Protein (H00007432-P02)

Learn more about PTMs related to VIP Recombinant Protein (H00007432-P02).
 

Research Areas for VIP Recombinant Protein (H00007432-P02)

Find related products by research area.

Blogs on VIP

There are no specific blogs for VIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human VIP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol VIP
Entrez