VHR/DUSP3 Antibody (2C4)

Images

 
Sandwich ELISA: VHR/DUSP3 Antibody (2C4) [H00001845-M07] - Detection limit for recombinant GST tagged DUSP3 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
2C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

VHR/DUSP3 Antibody (2C4) Summary

Immunogen
DUSP3 (NP_004081 76 a.a. - 185 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRVLVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKEGKLKP
Specificity
DUSP3 (2C4)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DUSP3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for VHR/DUSP3 Antibody (2C4)

  • dual specificity phosphatase 3
  • dual specificity protein phosphatase 3
  • Dual specificity protein phosphatase VHR
  • DUSP3
  • EC 3.1.3.16
  • EC 3.1.3.48
  • Vaccinia H1-related phosphatase
  • vaccinia virus phosphatase VH1-related
  • VHR
  • VHRserine/threonine specific protein phosphatase

Background

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene maps in a region that contains the BRCA1 locus which confers susceptibility to breast and ovarian cancer. Although DUSP3 is expressed in both breast and ovarian tissues, mutation screening in breast cancer pedigrees and in sporadic tumors was negative, leading to the conclusion that this gene is not BRCA1. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1366
Species: Hu
Applications: WB, Simple Western, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-834
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB7475
Species: Hu, Rt
Applications: WB
AF1649
Species: Hu, Mu, Rt
Applications: WB, ICC
AF4937
Species: Hu
Applications: WB, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
H00005250-B02P
Species: Hu
Applications: WB, ICC/IF
H00011266-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001845-M07
Species: Hu
Applications: ELISA

Publications for VHR/DUSP3 Antibody (H00001845-M07) (0)

There are no publications for VHR/DUSP3 Antibody (H00001845-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VHR/DUSP3 Antibody (H00001845-M07) (0)

There are no reviews for VHR/DUSP3 Antibody (H00001845-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for VHR/DUSP3 Antibody (H00001845-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VHR/DUSP3 Products

Bioinformatics Tool for VHR/DUSP3 Antibody (H00001845-M07)

Discover related pathways, diseases and genes to VHR/DUSP3 Antibody (H00001845-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VHR/DUSP3 Antibody (H00001845-M07)

Discover more about diseases related to VHR/DUSP3 Antibody (H00001845-M07).
 

Pathways for VHR/DUSP3 Antibody (H00001845-M07)

View related products by pathway.

PTMs for VHR/DUSP3 Antibody (H00001845-M07)

Learn more about PTMs related to VHR/DUSP3 Antibody (H00001845-M07).
 

Research Areas for VHR/DUSP3 Antibody (H00001845-M07)

Find related products by research area.

Blogs on VHR/DUSP3

There are no specific blogs for VHR/DUSP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VHR/DUSP3 Antibody (2C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol DUSP3
Entrez
Uniprot