VARS2 Antibody

Images

 
Western Blot: VARS2 Antibody [NBP2-49627] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry: VARS2 Antibody [NBP2-49627] - Staining of human gallbladder shows moderate positivity with granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VARS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VARS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VARS2 Recombinant Protein Antigen (NBP2-49627PEP)

Reactivity Notes

Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VARS2 Antibody

  • DKFZP434L1435
  • EC 6.1.1
  • EC 6.1.1.9
  • Em:AB023048.4
  • KIAA1885MGC138259
  • MGC142165
  • valine tRNA ligase 2, mitochondrial (putative)
  • Valine--tRNA ligase
  • valRS
  • valyl-tRNA synthetase 2, mitochondrial (putative)
  • valyl-tRNA synthetase 2-like
  • valyl-tRNA synthetase like
  • valyl-tRNA synthetase, mitochondrial
  • Valyl-tRNA synthetase-like
  • VARS2L
  • VARSL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83059
Species: Hu
Applications: IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBL1-11392
Species: Hu
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
NBP2-30371
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for VARS2 Antibody (NBP2-49627) (0)

There are no publications for VARS2 Antibody (NBP2-49627).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VARS2 Antibody (NBP2-49627) (0)

There are no reviews for VARS2 Antibody (NBP2-49627). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VARS2 Antibody (NBP2-49627) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VARS2 Products

Bioinformatics Tool for VARS2 Antibody (NBP2-49627)

Discover related pathways, diseases and genes to VARS2 Antibody (NBP2-49627). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VARS2 Antibody (NBP2-49627)

Discover more about diseases related to VARS2 Antibody (NBP2-49627).
 

Pathways for VARS2 Antibody (NBP2-49627)

View related products by pathway.

Blogs on VARS2

There are no specific blogs for VARS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VARS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VARS2