VARS Antibody

Images

 
Western Blot: VARS Antibody [NBP2-13513] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4, Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: VARS Antibody [NBP2-13513] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: VARS Antibody [NBP2-13513] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, AG, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VARS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASG YPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VARS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Aggregation
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VARS Protein (NBP2-13513PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VARS Antibody

  • EC 6.1.1
  • EC 6.1.1.9
  • G7AVARS1
  • Protein G7a
  • valine tRNA ligase 1, cytoplasmic
  • Valine--tRNA ligase
  • ValRS
  • valyl-tRNA synthetase 2
  • valyl-tRNA synthetase
  • VARS2valRS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87698
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84637
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92106
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83059
Species: Hu
Applications: IHC, IHC-P
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
H00003304-M02
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86624
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57136
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-14360
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-86889
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13513
Species: Hu, Mu, Rt
Applications: WB, AG, ICC/IF, IHC, IHC-P

Publications for VARS Antibody (NBP2-13513) (0)

There are no publications for VARS Antibody (NBP2-13513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VARS Antibody (NBP2-13513) (0)

There are no reviews for VARS Antibody (NBP2-13513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for VARS Antibody (NBP2-13513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VARS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VARS