VAC14 Antibody (3B2) - Azide and BSA Free Summary
Immunogen |
VAC14 (NP_060522.3, 714 a.a. ~ 782 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL |
Specificity |
Reacts with Vac14 homolog (S. cerevisiae). |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
VAC14 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
Application Notes |
This antibody is reactive against recombinant protein in western blot and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for VAC14 Antibody (3B2) - Azide and BSA Free
Background
Phosphatidylinositol 3,5-bisphosphate (PI(3,5)P2) is a low-abundance signaling molecule. A regulatory complex made up of VAC14 and FIG4 (MIM 609390) control synthesis of PI(3,5)P2 by activating PI(3)P kinase, FAB1 (PIP5K3; MIM 609414). The VAC14/FIG4 complex also functions in the breakdown of PI(3,5)P2 (Zhang et al., 2007 [PubMed 17956977]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, IHC-Fr, IHC-P, IP, KO, PLA, Simple Western, WB
Species: Mu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Bv, Hu
Applications: DB, ELISA, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu
Applications: WB, ELISA
Publications for VAC14 Antibody (H00055697-M03) (0)
There are no publications for VAC14 Antibody (H00055697-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for VAC14 Antibody (H00055697-M03) (0)
There are no reviews for VAC14 Antibody (H00055697-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for VAC14 Antibody (H00055697-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional VAC14 Products
Research Areas for VAC14 Antibody (H00055697-M03)
Find related products by research area.
|
Blogs on VAC14