UTS2D Antibody

Images

 
Western Blot: UTS2D Antibody [H00257313-B01P] - Analysis of UTS2D expression in transfected 293T cell line by UTS2D polyclonal antibody. Lane 1: UTS2D transfected lysate(13.09 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UTS2D Antibody Summary

Immunogen
UTS2D (NP_937795.1, 1 a.a. - 119 a.a.) full-length human protein. MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
Specificity
UTS2D - urotensin 2 domain containing,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UTS2D
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UTS2D Antibody

  • MGC138371
  • U2B
  • U-IIB
  • urotensin 2 domain containing
  • Urotensin IIB
  • Urotensin II-related peptide
  • Urotensin-2 domain-containing protein
  • urotensin-2B
  • URPUIIB
  • UTS2B

Background

Potent vasoconstrictor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94140
Species: Hu, Mu, Rt
Applications: WB
QET00B
Species: Hu
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-69148
Species: Hu, Rt
Applications: ELISA, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
9134-TN
Species: Hu
Applications: BA
NB100-1595
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP3-12450
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, SB, WB
MAB40401
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-45641
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89883
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-14873
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
AF1543
Species: Hu
Applications: IHC, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for UTS2D Antibody (H00257313-B01P) (0)

There are no publications for UTS2D Antibody (H00257313-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTS2D Antibody (H00257313-B01P) (0)

There are no reviews for UTS2D Antibody (H00257313-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTS2D Antibody (H00257313-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UTS2D Products

Bioinformatics Tool for UTS2D Antibody (H00257313-B01P)

Discover related pathways, diseases and genes to UTS2D Antibody (H00257313-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UTS2D Antibody (H00257313-B01P)

Discover more about diseases related to UTS2D Antibody (H00257313-B01P).
 

Pathways for UTS2D Antibody (H00257313-B01P)

View related products by pathway.

PTMs for UTS2D Antibody (H00257313-B01P)

Learn more about PTMs related to UTS2D Antibody (H00257313-B01P).

Blogs on UTS2D

There are no specific blogs for UTS2D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTS2D Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UTS2D
Entrez
Uniprot