Home » UTS2D » UTS2D Antibodies » UTS2D Antibody

UTS2D Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: UTS2D Antibody [H00257313-B01P] - Analysis of UTS2D expression in transfected 293T cell line by UTS2D polyclonal antibody. Lane 1: UTS2D transfected lysate(13.09 KDa). Lane 2: Non-transfected lysate.
Western Blot: UTS2D Antibody [H00257313-B01P] - Analysis of UTS2D expression in transfected 293T cell line by UTS2D polyclonal antibody. Lane 1: UTS2D transfected lysate(13.09 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

UTS2D Antibody Summary

Immunogen
UTS2D (NP_937795.1, 1 a.a. - 119 a.a.) full-length human protein. MNKILSSTVCFGLLTLLSVLIFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
Specificity
UTS2D - urotensin 2 domain containing,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
UTS2D
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UTS2D Antibody

  • MGC138371
  • U2B
  • U-IIB
  • urotensin 2 domain containing
  • Urotensin IIB
  • Urotensin II-related peptide
  • Urotensin-2 domain-containing protein
  • urotensin-2B
  • URPUIIB
  • UTS2B

Background

Potent vasoconstrictor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Urotensin-2
Antibody
NBP2-94140
Western Blot: Urotensin-2 Antibody [NBP2-94140] - Analysis of extracts of various cell lines, using Urotensin-2 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: WB
Endothelin-1 [HRP]
QET00B
(40 Publications)
Species: Hu
Applications: ELISA
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence: Somatostatin Antibody (7G5) [NBP2-37447] - Paraffin-embedded human adult pancreas tissue. pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of lung cancer tissues using SST mouse mAb with DAB staining.
ELISA: Somatostatin Antibody (7G5) [NBP2-37447] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Corticotropin
Releasing Factor Anti ...
H00001392-M02
Western Blot: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody (M02), clone 2B11.Lane 1: CRH transfected lysate(21.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Detection limit for recombinant GST tagged CRH is 0.3 ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Cortistatin
Antibody
NBP1-69148
Western Blot: Cortistatin Antibody [NBP1-69148] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
(1 Publication)
Species: Hu, Rt
Applications: ELISA, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
C1QL1
[Unconjugated]
9134-TN
When Recombinant Human C1qTNF14/C1qL1 (Catalog # 9134-TN) is coated at 1 µg/mL (100 μL/well), Recombinant Human BAI3 (Catalog # (Catalog # 9106-BA) binds with a typical ED50 of 0.4-2.4 μg/mL.
Species: Hu
Applications: BA
Ribosomal Protein
S6/RPS6 Antibody
NB100-1595
Immunohistochemistry-Paraffin: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Section of human lung carcinoma. Antibody: Affinity purified rabbit anti-RPS6 (NB100-1595). Detection: DAB
Western Blot: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human and mouse RPS6 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TCMK-1, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-RPS6 antibody NB100-1595 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.Previous
Immunoprecipitation: Ribosomal Protein S6/RPS6 Antibody [NB100-1595] - Detection of human RPS6 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-RPS6 antibody NB100-1595 (lot NB100-1595-2) used for IP at 6 ug per reaction. RPS6 was also immunoprecipitated by a previous lot of this antibody (lot NB100-1595-1). For blotting immunoprecipitated RPS6, NB100-1595 was used at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
UCN2 Antibody
NBP3-12450
Immunohistochemistry-Paraffin: UCN2 Antibody [NBP3-12450] - Mouse colon. 1:1000 dilution in IHC blocking buffer. DAB (brown) staining in Hematoxylin QS (blue) counterstain. 5x magnification.
Immunohistochemistry-Paraffin: UCN2 Antibody [NBP3-12450] - Mouse colon. 1:1000 dilution in IHC blocking buffer. DAB (brown) staining in Hematoxylin QS (blue) counterstain. 40 magnification.
Immunohistochemistry-Paraffin: UCN2 Antibody [NBP3-12450] - Mouse liver. 1:1000 dilution in IHC blocking buffer. DAB (brown) staining in Hematoxylin QS (blue) counterstain. 5X magnification.
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, SB, WB
TSC2 Antibody
(614204) [Unconjugate
MAB40401
Western blot shows lysates of HEK293 human embryonic kidney cell line, HeLa human cervical epithelial carcinoma cell line, Daudi human Burkitt's lymphoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for TSC2 at approximately 200 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
TSC2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
TSC2 was detected in immersion fixed paraffin-embedded sections of human kidney using Mouse Anti-Human/Mouse TSC2 Monoclonal Antibody (Catalog # MAB40401) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to epithelial cell cytoplasm in convoluted tubules. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu, Mu
Applications: ICC, IHC, WB
FERMT3/URP2
Antibody (OTI3C7)
NBP2-45641
Immunohistochemistry: FERMT3/URP2 Antibody (3C7) [NBP2-45641] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: FERMT3/URP2 Antibody (3C7) [NBP2-45641] - Analysis of Adenocarcinoma of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: FERMT3/URP2 Antibody (3C7) [NBP2-45641] - Analysis of Carcinoma of Human liver tissue.(Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Kindlin Antibody
NBP1-89883
Immunohistochemistry-Paraffin: Kindlin Antibody [NBP1-89883] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Western Blot: Kindlin Antibody [NBP1-89883] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu
Applications: IHC, IHC-P, WB
preproANP Antibody
NBP2-14873
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Mouse muscle. ANP antibody [N1C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Mouse heart. ANP stained by preproANP antibody diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: preproANP Antibody [NBP2-14873] - Mouse heart. preproANP stained by preproANP antibody diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(6 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on Jurkat cells with Alexa Fluor 647 conjugate of GPR78/HSPA5 antibody NBP1-06274AF647 (blue) and a matched isotype control NBP2-24893AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: GRP78/HSPA5 Antibody [NBP1-06274] - An intracellular stain was performed on HeLa with NBP1-06274 and a matched isotype control. Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Rabbit IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550.
Immunocytochemistry/Immunofluorescence: GRP78/HSPA5 Antibody [NBP1-06274] - NIH-3T3 cells were fixed and permeabilized for 10 minutes using -20C MeOH. The cells were incubated with anti-GRP78/HSPA5 at 2 ug/mL overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
(2 Reviews)
(38 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
BMP-3b/GDF-10
Antibody [Unconjugate
AF1543
BMP-3b/GDF-10 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen: Tyrosine Hydroxylase Antibody [NB300-109] - 10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the mushroom body. All panels show a right brain hemisphere (dorsal to the top, medial to the right), except panels M-O (posterior to the top). Tyrosine hydroxylase (TH) immunoreactivity is shown in magenta (A, D, G, J, M) and synapsin immunoreactivity in green (B, E, H, K, N). Corresponding merged images in C, F, I, L, O. Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
Immunohistochemistry: Tyrosine Hydroxylase Antibody [NB300-109] - Tyrosine hydroxylase immunoreactivity in the central complex and the lateral accessory lobe. A-D: Frontal sections (immunoperoxidase preparations, dorsal to the top). E: Horizontal section (immunofluorescent preparation, posterior to the top). Scale bars = 100 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0160531), licensed under a CC-BY licence.
(7 Reviews)
(177 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB

Publications for UTS2D Antibody (H00257313-B01P) (0)

There are no publications for UTS2D Antibody (H00257313-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UTS2D Antibody (H00257313-B01P) (0)

There are no reviews for UTS2D Antibody (H00257313-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UTS2D Antibody (H00257313-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UTS2D Products

Bioinformatics Tool for UTS2D Antibody (H00257313-B01P)

Discover related pathways, diseases and genes to UTS2D Antibody (H00257313-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UTS2D Antibody (H00257313-B01P)

Discover more about diseases related to UTS2D Antibody (H00257313-B01P).
 

Pathways for UTS2D Antibody (H00257313-B01P)

View related products by pathway.

PTMs for UTS2D Antibody (H00257313-B01P)

Learn more about PTMs related to UTS2D Antibody (H00257313-B01P).

Blogs on UTS2D

There are no specific blogs for UTS2D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UTS2D Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol UTS2D
Entrez
Uniprot