Recombinant Human UT2/SLC14A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UT2/SLC14A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 40-128 of Human SLC14A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC14A2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UT2/SLC14A2 Protein

  • FLJ16167
  • HUT2UT-A2
  • hUT-A6
  • MGC119566
  • SLC14A2
  • solute carrier family 14 (urea transporter), member 2
  • Solute carrier family 14 member 2
  • urea transporter 2
  • Urea transporter, kidney
  • urea transporter-2
  • UT2
  • UT2MGC119567
  • UTA
  • UT-A2
  • UTR

Background

SLC14A2 - solute carrier family 14 (urea transporter), member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8238
Species: Hu
Applications: Flow, CyTOF-ready
AF2030
Species: Hu
Applications: WB, IHC
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33872
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87679
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-749
Species: Hu, Mu, Rt, Rb, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
NB120-3446
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, ICC, IF
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-12446
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00008170-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01) (0)

There are no publications for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01) (0)

There are no reviews for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UT2/SLC14A2 Products

Bioinformatics Tool for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01)

Discover related pathways, diseases and genes to UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01)

Discover more about diseases related to UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01).
 

Pathways for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01)

View related products by pathway.

PTMs for UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01)

Learn more about PTMs related to UT2/SLC14A2 Partial Recombinant Protein (H00008170-Q01).

Blogs on UT2/SLC14A2

There are no specific blogs for UT2/SLC14A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NFAT5 Antibody
NB120-3446

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UT2/SLC14A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC14A2
Entrez