Recombinant Human USP52 Protein

Images

 
SDS-Page: Recombinant Human USP52 Protein [H00009924-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human USP52 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1099-1198 of Human USP52

Source: Wheat Germ

Amino Acid Sequence: TVYLFHMPRKRMISLRFLAWYFLDLKIQGETHDSIEDARTALQLYRKYLELSKNGTEPESFHKVLKGLYEKGRKMDWKVPEPEGQTSPKNAAVFSSVLAL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
PAN2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human USP52 Protein

  • EC 3.1.13.4
  • FLJ39360
  • hPan2
  • Inactive ubiquitin carboxyl-terminal hydrolase 52
  • KIAA0710PAB-dependent poly(A)-specific ribonuclease subunit 2
  • NALP4
  • PABP-dependent poly(A) nuclease 2
  • PAN2 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
  • PAN2 polyA specific ribonuclease subunit
  • PYPAF4
  • ubiquitin specific peptidase 52
  • ubiquitin specific protease 52
  • USP52

Background

USP52 - ubiquitin specific protease 52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15930
Species: Hu
Applications: WB, ICC/IF
H00029883-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86564
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1567
Species: Hu
Applications: Flow, CyTOF-reported
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP, KO
NBP2-46321
Species: Hu
Applications: WB, IHC
NBP2-44286
Species: Hu
Applications: WB, IP
NBP2-31892
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-87256
Species: Hu
Applications: IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
AF6116
Species: Hu
Applications: WB, ICC
MAB829
Species: Hu
Applications: WB, IHC
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for USP52 Partial Recombinant Protein (H00009924-Q01) (0)

There are no publications for USP52 Partial Recombinant Protein (H00009924-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for USP52 Partial Recombinant Protein (H00009924-Q01) (0)

There are no reviews for USP52 Partial Recombinant Protein (H00009924-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for USP52 Partial Recombinant Protein (H00009924-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for USP52 Partial Recombinant Protein (H00009924-Q01)

Discover related pathways, diseases and genes to USP52 Partial Recombinant Protein (H00009924-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USP52 Partial Recombinant Protein (H00009924-Q01)

Discover more about diseases related to USP52 Partial Recombinant Protein (H00009924-Q01).
 

Pathways for USP52 Partial Recombinant Protein (H00009924-Q01)

View related products by pathway.

Blogs on USP52

There are no specific blogs for USP52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

USP52 Antibody (6A7)
H00009924-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human USP52 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol PAN2