Urotensin-2 Antibody (3B2M6)

Western Blot: Urotensin-2 Antibody (3B2M6) [NBP3-33403] - Western blot analysis of lysates from Rat brain, using Urotensin-2(UTS2) Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.

• Reactivity: Rt
• Applications: WB, ELISA
• Clone: 3B2M6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Urotensin-2 Antibody (3B2M6) Summary

• Description: Novus Biologicals Rabbit Urotensin-2 Antibody (3B2M6) (NBP3-33403) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 20-124 of human Urotensin-2 (UTS2). (NP_006777.1).
  
  Sequence:
  SLPLLDSREISFQLSAPHEDARLTPEELERASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: UTS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:100 - 1:500
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Urotensin-2 Antibody (3B2M6)

• UCN2
• UII
• UIIPRO1068
• U-IIUrotensin II
• urotensin 2
• urotensin-2
• UrotensinII
• Urotensin-II
• UTS2

Background

Urotensin-2 encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UTS2