UGT2A3 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to UGT2A3(UDP glucuronosyltransferase 2 family, polypeptide A3) The peptide sequence was selected form the middle region of UGT2A3. Peptide sequence GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTR. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
UGT2A3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for UGT2A3 Antibody - BSA Free
Background
UGT2A3 belongs to the UDP-glycosyltransferase family. UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: WB
Publications for UGT2A3 Antibody (NBP1-62332) (0)
There are no publications for UGT2A3 Antibody (NBP1-62332).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for UGT2A3 Antibody (NBP1-62332) (0)
There are no reviews for UGT2A3 Antibody (NBP1-62332).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for UGT2A3 Antibody (NBP1-62332) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional UGT2A3 Products
Research Areas for UGT2A3 Antibody (NBP1-62332)
Find related products by research area.
|
Blogs on UGT2A3