UGT1A4 Antibody

Western Blot: UGT1A4 Antibody [NBP1-69412] - This Anti-UGT1A4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Discontinued

UGT1A4 Antibody Summary

• Immunogen: Synthetic peptides corresponding to UGT1A4(UDP glucuronosyltransferase 1 family, polypeptide A4) The peptide sequence was selected from the N terminal of UGT1A4. Peptide sequence VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: UGT1A4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:100-1:2000
• Application Notes: This is a rabbit polyclonal antibody against UGT1A4 and was validated on Western blot.
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified
• Reconstitution Instructions: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT1A4 Antibody

• bilirubin UDP-glucuronosyltransferase isozyme 2
• Bilirubin-specific UDPGT isozyme 2
• GNT1
• HUG-BR2
• polypeptide A4
• UDP glucuronosyltransferase 1 family, polypeptide A4
• UDP-glucuronosyltransferase 1-4
• UDP-glucuronosyltransferase 1A4
• UDP-glucuronosyltransferase 1-D
• UDPGT 1-4
• UDPGT
• UGT1
• UGT1*4
• UGT1.4
• UGT1-04
• UGT-1D
• UGT1DEC 2.4.1.17

Background

UGT1A4 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UGT1A4
• Uniprot:
  • P22310(Human)