UGT1A4 Antibody

Images

 
Western Blot: UGT1A4 Antibody [NBP1-69412] - This Anti-UGT1A4 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
LYOPH

Order Details

UGT1A4 Antibody Summary

Immunogen
Synthetic peptides corresponding to UGT1A4(UDP glucuronosyltransferase 1 family, polypeptide A4) The peptide sequence was selected from the N terminal of UGT1A4. Peptide sequence VVLTPEVNMHIKEEKFFTLTAYAVPWTQKEFDRVTLGYTQGFFETEHLLK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGT1A4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UGT1A4 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
LYOPH
Purity
Immunogen affinity purified
Reconstitution Instructions
Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGT1A4 Antibody

  • bilirubin UDP-glucuronosyltransferase isozyme 2
  • Bilirubin-specific UDPGT isozyme 2
  • GNT1
  • HUG-BR2
  • polypeptide A4
  • UDP glucuronosyltransferase 1 family, polypeptide A4
  • UDP-glucuronosyltransferase 1-4
  • UDP-glucuronosyltransferase 1A4
  • UDP-glucuronosyltransferase 1-D
  • UDPGT 1-4
  • UDPGT
  • UGT1
  • UGT1*4
  • UGT1.4
  • UGT1-04
  • UGT-1D
  • UGT1DEC 2.4.1.17

Background

UGT1A4 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. This enzyme has some glucuronidase activity towards bilirubin, although is is more active on amines, steroids, and sapogenins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
H00007366-B01P
Species: Hu
Applications: WB
NBP2-06724
Species: Hu
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-20803
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-69412
Species: Hu
Applications: WB

Publications for UGT1A4 Antibody (NBP1-69412) (0)

There are no publications for UGT1A4 Antibody (NBP1-69412).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGT1A4 Antibody (NBP1-69412) (0)

There are no reviews for UGT1A4 Antibody (NBP1-69412). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGT1A4 Antibody (NBP1-69412) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGT1A4 Products

Bioinformatics Tool for UGT1A4 Antibody (NBP1-69412)

Discover related pathways, diseases and genes to UGT1A4 Antibody (NBP1-69412). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGT1A4 Antibody (NBP1-69412)

Discover more about diseases related to UGT1A4 Antibody (NBP1-69412).
 

Pathways for UGT1A4 Antibody (NBP1-69412)

View related products by pathway.

PTMs for UGT1A4 Antibody (NBP1-69412)

Learn more about PTMs related to UGT1A4 Antibody (NBP1-69412).

Blogs on UGT1A4

There are no specific blogs for UGT1A4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGT1A4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGT1A4
Uniprot