Recombinant Human UGRP1/SCGB3A2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human UGRP1/SCGB3A2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 93 of Human SCGB3A2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SCGB3A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00117156-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UGRP1/SCGB3A2 Protein

  • LU103
  • Pneumo secretory protein 1
  • PnSP-1
  • PNSP1secretoglobin family 3A member 2
  • SCGB3A2
  • secretoglobin, family 3A, member 2
  • UGRP1
  • UGRP1pnSP-1
  • Uteroglobin-related protein 1

Background

SCGB3A2( AAH24232, 1 a.a. - 94 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4218
Species: Hu
Applications: WB, IHC
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
AF2790
Species: Hu
Applications: WB
NBP2-65693
Species: Hu
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-64688
Species: Hu
6507-IL/CF
Species: Hu
409-ML/CF
Species: Mu
NB500-470
Species: Hu
Applications: ELISA, Flow
NBP1-51671
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87736
Species: Hu
Applications: WB, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-32387
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-39004
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00117156-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01)(1)

Reviews for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01) (0)

There are no reviews for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01)

Discover related pathways, diseases and genes to UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01)

Discover more about diseases related to UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01).
 

Pathways for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01)

View related products by pathway.

PTMs for UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01)

Learn more about PTMs related to UGRP1/SCGB3A2 Recombinant Protein (H00117156-P01).

Blogs on UGRP1/SCGB3A2

There are no specific blogs for UGRP1/SCGB3A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4
6507-IL-010/CF
Ovalbumin Antibody
NB600-922-0.1mg
MARCO Antibody
NBP2-39004

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UGRP1/SCGB3A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SCGB3A2