UGCGL2 Antibody (NBP1-79299)

Images

 
Western Blot: UGCGL2 Antibody [NBP1-79299] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

UGCGL2 Antibody Summary

Immunogen
Synthetic peptide directed towards the N terminal of human UGCGL2The immunogen for this antibody is UGCGL2. Peptide sequence KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UGGT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against UGCGL2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for UGCGL2 Antibody

  • FLJ10873
  • HUGT2
  • MGC117360
  • UDP-Glc:glycoprotein glucosyltransferase 2
  • UDP-glucose ceramide glucosyltransferase-like 1
  • UDP-glucose glycoprotein glucosyltransferase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6490
Species: Hu
Applications: WB, IHC, ICC
H00054575-Q01
Species: Hu
NBP1-69412
Species: Hu
Applications: WB
H00054600-B01P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33743
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00054659-M02
Species: Hu
Applications: WB, ELISA
NBP1-72063
Species: Rt
Applications: WB, PEP-ELISA
H00007364-M02-100ug
Species: Hu, Rt
Applications: WB, ELISA
H00007366-B01P
Species: Hu
Applications: WB
H00007363-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00007365-R01
Species: Hu
NBP1-84494
Species: Hu
Applications: IHC, IHC-P
NBP1-91335
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-86458
Species: Hu
Applications: IHC, IHC-P
NBP1-77681
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for UGCGL2 Antibody (NBP1-79299) (0)

There are no publications for UGCGL2 Antibody (NBP1-79299).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UGCGL2 Antibody (NBP1-79299) (0)

There are no reviews for UGCGL2 Antibody (NBP1-79299). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UGCGL2 Antibody (NBP1-79299) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UGCGL2 Products

Related Products by Gene

Bioinformatics Tool for UGCGL2 Antibody (NBP1-79299)

Discover related pathways, diseases and genes to UGCGL2 Antibody (NBP1-79299). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on UGCGL2

There are no specific blogs for UGCGL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UGCGL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UGGT2
Uniprot