Uev1a/UBE2V1 Antibody

Images

 
Western Blot: Uev1a/UBE2V1 Antibody [NBP2-88552] - Host: Rabbit. Target Name: UBE2V1. Sample Tissue: Human U937 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Uev1a/UBE2V1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human Uev1a/UBE2V1. Peptide sequence: IYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
UBE2V1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Uev1a/UBE2V1 Antibody

  • CIR1
  • CROC1
  • CROC1TRAF6-regulated IKK activator 1 beta Uev1A
  • CROC-1UBE2V
  • UBE2V1
  • ubiquitin-conjugating enzyme E2 variant 1
  • Uev1a
  • UEV-1CIR1
  • UEV1DNA-binding protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56360
Species: Hu
Applications: WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
E2-627
Species: Hu
Applications: EnzAct
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
U-100H
Species: Hu
Applications: EnzAct
NBP2-94633
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-130
Species: Bv, Ce, Ch, Dr, Eq, Hu, Pm, Mu, Pl, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
NBP2-46228
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for Uev1a/UBE2V1 Antibody (NBP2-88552) (0)

There are no publications for Uev1a/UBE2V1 Antibody (NBP2-88552).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Uev1a/UBE2V1 Antibody (NBP2-88552) (0)

There are no reviews for Uev1a/UBE2V1 Antibody (NBP2-88552). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Uev1a/UBE2V1 Antibody (NBP2-88552) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Uev1a/UBE2V1 Products

Bioinformatics Tool for Uev1a/UBE2V1 Antibody (NBP2-88552)

Discover related pathways, diseases and genes to Uev1a/UBE2V1 Antibody (NBP2-88552). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Uev1a/UBE2V1 Antibody (NBP2-88552)

Discover more about diseases related to Uev1a/UBE2V1 Antibody (NBP2-88552).
 

Pathways for Uev1a/UBE2V1 Antibody (NBP2-88552)

View related products by pathway.

PTMs for Uev1a/UBE2V1 Antibody (NBP2-88552)

Learn more about PTMs related to Uev1a/UBE2V1 Antibody (NBP2-88552).
 

Research Areas for Uev1a/UBE2V1 Antibody (NBP2-88552)

Find related products by research area.

Blogs on Uev1a/UBE2V1

There are no specific blogs for Uev1a/UBE2V1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Uev1a/UBE2V1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2V1