Recombinant Human UBR2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human UBR2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-439 of Human UBR2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKVQVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDSKLWKGARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYERLQSDYVTDDHDREFSVADLSVQIFTVPSLFSISAGRSGSPL

Protein/Peptide Type
Recombinant Protein
Gene
UBR2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
20 mM Tris, pH 8.0, 10 % glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human UBR2 Protein

  • bA49A4.1
  • C6orf133MGC71112
  • chromosome 6 open reading frame 133
  • dJ242G1.1
  • dJ392M17.3
  • DKFZp686C08114
  • E3 ubiquitin-protein ligase UBR2
  • EC 6.3.2.-
  • KIAA0349FLJ36357
  • N-recognin-2
  • RP3-392M17.3
  • ubiquitin protein ligase E3 component n-recognin 2
  • Ubiquitin-protein ligase E3-alpha-2
  • Ubiquitin-protein ligase E3-alpha-II

Background

Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron (Kwon et al., 2003 [PubMed 14585983]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86253
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31293
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-28730
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-553
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-88409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P

Publications for UBR2 Recombinant Protein (H00023304-P01) (0)

There are no publications for UBR2 Recombinant Protein (H00023304-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBR2 Recombinant Protein (H00023304-P01) (0)

There are no reviews for UBR2 Recombinant Protein (H00023304-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBR2 Recombinant Protein (H00023304-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional UBR2 Products

Bioinformatics Tool for UBR2 Recombinant Protein (H00023304-P01)

Discover related pathways, diseases and genes to UBR2 Recombinant Protein (H00023304-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBR2 Recombinant Protein (H00023304-P01)

Discover more about diseases related to UBR2 Recombinant Protein (H00023304-P01).
 

Pathways for UBR2 Recombinant Protein (H00023304-P01)

View related products by pathway.

PTMs for UBR2 Recombinant Protein (H00023304-P01)

Learn more about PTMs related to UBR2 Recombinant Protein (H00023304-P01).

Blogs on UBR2

There are no specific blogs for UBR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

UBR2 Antibody
NBP1-45243

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human UBR2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol UBR2