Ubiquitin-activating Enzyme/UBE1 Antibody

Images

 
Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody [NBP1-90307] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: Ubiquitin-activating Enzyme/UBE1 Antibody [NBP1-90307] - Staining of human cerebral cortex shows distinct nuclear positivity in glial cells.
Western Blot: Ubiquitin-activating Enzyme/UBE1 Antibody [NBP1-90307] - Analysis in human cell line HEK 293.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ubiquitin-activating Enzyme/UBE1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ubiquitin-activating Enzyme/UBE1 Protein (NBP1-90307PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ubiquitin-activating Enzyme/UBE1 Antibody

  • A1S9T and BN75 temperature sensitivity complementing
  • A1S9T
  • A1ST
  • AMCX1
  • GXP1
  • MGC4781
  • POC20 centriolar protein homolog
  • POC20
  • Protein A1S9
  • SMAX2
  • UBA1
  • UBA1, ubiquitin-activating enzyme E1 homolog A
  • UBA1A
  • UBE1
  • UBE1A1S9
  • UBE1X
  • ubiquitin-activating enzyme E1 (A1S9T and BN75 temperature sensitivitycomplementing)
  • Ubiquitin-activating enzyme E1
  • Ubiquitinactivating Enzyme
  • Ubiquitin-activating Enzyme
  • ubiquitin-like modifier activating enzyme 1
  • ubiquitin-like modifier-activating enzyme 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
NBP1-87911
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
A-306
Species: Hu
Applications: WB, IHC
NBP1-82761
Species: Hu
Applications: IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP2-55541
Species: Hu
Applications: WB, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-49443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46538
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307) (0)

There are no publications for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307) (0)

There are no reviews for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ubiquitin-activating Enzyme/UBE1 Products

Bioinformatics Tool for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307)

Discover related pathways, diseases and genes to Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307)

Discover more about diseases related to Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307).
 

Pathways for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307)

View related products by pathway.

PTMs for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307)

Learn more about PTMs related to Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307).
 

Research Areas for Ubiquitin-activating Enzyme/UBE1 Antibody (NBP1-90307)

Find related products by research area.

Blogs on Ubiquitin-activating Enzyme/UBE1

There are no specific blogs for Ubiquitin-activating Enzyme/UBE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ubiquitin-activating Enzyme/UBE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBA1
Entrez