UBE2T Antibody (2A12-4F11)

Images

 
Western Blot: UBE2T Antibody (2A12-4F11) [H00029089-M03] - Analysis of UBE2T expression in transfected 293T cell line by UBE2T monoclonal antibody (M03), clone 2A12-4F11. Lane 1: UBE2T transfected lysatE (22.5 KDa). ...read more
Immunoprecipitation: UBE2T Antibody (2A12-4F11) [H00029089-M03] - Analysis of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2T rabbit polyclonal ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2A12-4F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBE2T Antibody (2A12-4F11) Summary

Immunogen
UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Specificity
UBE2T - ubiquitin-conjugating enzyme E2T (putative) (2A12-4F11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2T
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoprecipitation
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2T Antibody (2A12-4F11)

  • Cell proliferation-inducing gene 50 protein
  • EC 6.3.2.19
  • HSPC150 protein similar to ubiquitin-conjugating enzyme
  • HSPC150
  • PIG50
  • UBE2T
  • Ubiquitin carrier protein T
  • ubiquitin conjugating enzyme
  • ubiquitin-conjugating enzyme E2 T
  • ubiquitin-conjugating enzyme E2T (putative)
  • Ubiquitin-protein ligase T

Background

The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67835
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
NBP1-76593
Species: Hu, Mu, Rt
Applications: ELISA, IF, IHC, IHC-P, WB
NBP3-15271
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-182
Species: Av, Ca, Hu, Ma, Mu, Pm, Rt, Ze
Applications: ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, RNAi, Simple Western, WB
MAB6609
Species: Hu, Mu
Applications: IHC, WB
NB100-56360
Species: Hu
Applications: WB
NBP1-84758
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
E2-640
Species: Hu
Applications: EnzAct
NB300-812
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB

Publications for UBE2T Antibody (H00029089-M03) (0)

There are no publications for UBE2T Antibody (H00029089-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for UBE2T Antibody (H00029089-M03) (0)

There are no reviews for UBE2T Antibody (H00029089-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2T Antibody (H00029089-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional UBE2T Products

Array H00029089-M03

Bioinformatics Tool for UBE2T Antibody (H00029089-M03)

Discover related pathways, diseases and genes to UBE2T Antibody (H00029089-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2T Antibody (H00029089-M03)

Discover more about diseases related to UBE2T Antibody (H00029089-M03).
 

Pathways for UBE2T Antibody (H00029089-M03)

View related products by pathway.

PTMs for UBE2T Antibody (H00029089-M03)

Learn more about PTMs related to UBE2T Antibody (H00029089-M03).

Blogs on UBE2T

There are no specific blogs for UBE2T, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2T Antibody (2A12-4F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2T
Entrez
Uniprot