UBE2T Antibody (1E12-4A3)

Images

 
Western Blot: UBE2T Antibody (1E12-4A3) [H00029089-M01] - UBE2T monoclonal antibody (M01), clone 1E12-4A3 Analysis of UBE2T expression in Hela.
Immunoprecipitation: UBE2T Antibody (1E12-4A3) [H00029089-M01] - Analysis of UBE2T transfected lysate using anti-UBE2T monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UBE2T MaxPab rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
1E12-4A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UBE2T Antibody (1E12-4A3) Summary

Immunogen
UBE2T (AAH04152, 1 a.a. ~ 197 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
Specificity
UBE2T - ubiquitin-conjugating enzyme E2T (putative)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UBE2T
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00029089-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UBE2T Antibody (1E12-4A3)

  • Cell proliferation-inducing gene 50 protein
  • EC 6.3.2.19
  • HSPC150 protein similar to ubiquitin-conjugating enzyme
  • HSPC150
  • PIG50
  • UBE2T
  • Ubiquitin carrier protein T
  • ubiquitin conjugating enzyme
  • ubiquitin-conjugating enzyme E2 T
  • ubiquitin-conjugating enzyme E2T (putative)
  • Ubiquitin-protein ligase T

Background

The covalent conjugation of ubiquitin to proteins regulates diverse cellular pathways and proteins. Ubiquitin is transferred to a target protein through a concerted action of a ubiquitin-activating enzyme (E1), a ubiquitin-conjugating enzyme (E2), such as UBE2T, and a ubiquitin ligase (E3) (Machida et al., 2006 [PubMed 16916645]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-89134
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53246
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
E2-610
Species: Hu
NB100-182
Species: Hu, Mu, Rt, Av, Ca, Ma, Pm, Ze
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-P, IP, RNAi, KD, KO
MAB6609
Species: Hu, Mu
Applications: WB, IHC
NB100-56360
Species: Hu
Applications: WB
H00055120-D01P
Species: Hu
Applications: WB, ICC/IF
NB300-812
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO

Publications for UBE2T Antibody (H00029089-M01)(1)

Reviews for UBE2T Antibody (H00029089-M01) (0)

There are no reviews for UBE2T Antibody (H00029089-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UBE2T Antibody (H00029089-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UBE2T Products

Bioinformatics Tool for UBE2T Antibody (H00029089-M01)

Discover related pathways, diseases and genes to UBE2T Antibody (H00029089-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UBE2T Antibody (H00029089-M01)

Discover more about diseases related to UBE2T Antibody (H00029089-M01).
 

Pathways for UBE2T Antibody (H00029089-M01)

View related products by pathway.

PTMs for UBE2T Antibody (H00029089-M01)

Learn more about PTMs related to UBE2T Antibody (H00029089-M01).

Blogs on UBE2T

There are no specific blogs for UBE2T, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our UBE2T Antibody (1E12-4A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol UBE2T
Entrez
Uniprot