U11/U12-35K Recombinant Protein Antigen

Images

 
There are currently no images for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

U11/U12-35K Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SNRNP35.

Source: E. coli

Amino Acid Sequence: LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SNRNP35
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56203.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for U11/U12-35K Recombinant Protein Antigen

  • HM1
  • HM-1
  • MGC138160
  • Protein HM-1
  • small nuclear ribonucleoprotein 35kDa (U11/U12)
  • U1 snRNP-binding protein homolog
  • U11/U12 small nuclear ribonucleoprotein 35 kDa protein
  • U11/U12 snRNP 35 kDa protein
  • U11/U12 snRNP 35K
  • U11/U12-35K
  • U1-snRNP binding protein homolog
  • U1SNRNPBPU1 snRNP binding protein homolog

Background

The protein encoded by the U1SNRNPBP gene is a homolog of U1-snRNP binding protein. The N-terminal half contains a RNA recognition motif and the C-terminal is rich in Arg/Asp and Arg/Glu dipeptides; a characteristic of a variety of splicing factors. This protein is a component of the U11/U12 small nuclear ribonucleoproteins (snRNP) that form part of the U12-type spliceosome. This gene is differentially expressed in a variety of human tissues. Alternative splicing results in multiple transcript variants encoding distinct proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, In vivo
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NLS1331
Species: Bt, Bv, Ca, Gp, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC,  IHC-P
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
202-IL
Species: Hu
Applications: BA
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32905
Species: Bv, Hu, Pm, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
485-MI
Species: Mu
Applications: BA
361-MI
Species: Hu
Applications: BA
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-33527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, Simple Western, WB
NBP2-56203PEP
Species: Hu
Applications: AC

Publications for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP) (0)

There are no publications for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP) (0)

There are no reviews for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for U11/U12-35K Recombinant Protein Antigen (NBP2-56203PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional U11/U12-35K Products

Blogs on U11/U12-35K

There are no specific blogs for U11/U12-35K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our U11/U12-35K Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRNP35